BLASTX nr result
ID: Glycyrrhiza23_contig00025967
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00025967 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003614894.1| hypothetical protein MTR_5g060920 [Medicago ... 57 1e-06 ref|XP_003609678.1| ATP-dependent DNA helicase PIF1 [Medicago tr... 56 3e-06 ref|XP_003595510.1| Replication protein A 70 kDa DNA-binding sub... 56 3e-06 ref|XP_003599362.1| hypothetical protein MTR_3g032190 [Medicago ... 55 4e-06 ref|XP_003629969.1| Replication factor A protein [Medicago trunc... 55 6e-06 >ref|XP_003614894.1| hypothetical protein MTR_5g060920 [Medicago truncatula] gi|355516229|gb|AES97852.1| hypothetical protein MTR_5g060920 [Medicago truncatula] Length = 109 Score = 57.4 bits (137), Expect = 1e-06 Identities = 22/50 (44%), Positives = 34/50 (68%) Frame = -3 Query: 157 VNPRHDSVSSITPAKECWTIIARVLCLWFVTDFSKQKLSFSMEMVLQDDK 8 ++ +HD +S ++P K+ WT++ RV+ WF D+ +KL FSME VL D K Sbjct: 3 ISTKHDFISDVSPRKQSWTLVVRVVRAWFGQDYKNKKLPFSMEFVLMDQK 52 >ref|XP_003609678.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula] gi|355510733|gb|AES91875.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula] Length = 893 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/48 (52%), Positives = 34/48 (70%) Frame = -3 Query: 151 PRHDSVSSITPAKECWTIIARVLCLWFVTDFSKQKLSFSMEMVLQDDK 8 P+ D +S I+P+KE W I RV+ LWFV D K +L +S+EMVL D+K Sbjct: 3 PKIDLISDISPSKENWNIRVRVVRLWFVRDMKKDQLPYSLEMVLMDNK 50 >ref|XP_003595510.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula] gi|355484558|gb|AES65761.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula] Length = 549 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/48 (52%), Positives = 34/48 (70%) Frame = -3 Query: 151 PRHDSVSSITPAKECWTIIARVLCLWFVTDFSKQKLSFSMEMVLQDDK 8 P+ D +S I+P+KE W I RV+ LWFV D K +L +S+EMVL D+K Sbjct: 3 PKIDLISDISPSKENWNIRVRVVRLWFVRDMKKDQLPYSLEMVLMDNK 50 >ref|XP_003599362.1| hypothetical protein MTR_3g032190 [Medicago truncatula] gi|355488410|gb|AES69613.1| hypothetical protein MTR_3g032190 [Medicago truncatula] Length = 107 Score = 55.5 bits (132), Expect = 4e-06 Identities = 22/50 (44%), Positives = 34/50 (68%) Frame = -3 Query: 157 VNPRHDSVSSITPAKECWTIIARVLCLWFVTDFSKQKLSFSMEMVLQDDK 8 ++ +HD +S ++P K+ WT++ RV+ WF D+ +KL FSME VL D K Sbjct: 1 MSTKHDFISDVSPRKQSWTLVVRVVRAWFGQDYKNKKLPFSMEFVLIDQK 50 >ref|XP_003629969.1| Replication factor A protein [Medicago truncatula] gi|355523991|gb|AET04445.1| Replication factor A protein [Medicago truncatula] Length = 296 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/50 (44%), Positives = 35/50 (70%) Frame = -3 Query: 157 VNPRHDSVSSITPAKECWTIIARVLCLWFVTDFSKQKLSFSMEMVLQDDK 8 ++ +HD +S+++P K+ WT++ RV+ WF D+ +KL FSME VL D K Sbjct: 1 MSTKHDFISNVSPRKQSWTLVVRVVRAWFGQDYKNKKLPFSMEFVLIDRK 50