BLASTX nr result
ID: Glycyrrhiza23_contig00025932
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00025932 (433 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612583.1| Urea active transporter-like protein [Medica... 56 3e-06 ref|XP_003523904.1| PREDICTED: probable urea active transporter ... 55 5e-06 >ref|XP_003612583.1| Urea active transporter-like protein [Medicago truncatula] gi|355513918|gb|AES95541.1| Urea active transporter-like protein [Medicago truncatula] Length = 711 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -2 Query: 432 LHTIMQAIPEAERLYLLDKGKAKKLEASDSEQQQSCSLPL 313 LHTI+QAIPEAERLYLL+K K KKLEAS +QQS S+P+ Sbjct: 675 LHTIIQAIPEAERLYLLEKEKTKKLEAS---EQQSVSIPM 711 >ref|XP_003523904.1| PREDICTED: probable urea active transporter 1-like [Glycine max] Length = 714 Score = 55.5 bits (132), Expect = 5e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 432 LHTIMQAIPEAERLYLLDKGKAKKLEASDSEQQQSCSLP 316 L TIMQA+PEAERLYLL+KGKAKKL DS +QQ+ SLP Sbjct: 678 LQTIMQAMPEAERLYLLEKGKAKKL---DSSEQQASSLP 713