BLASTX nr result
ID: Glycyrrhiza23_contig00025915
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00025915 (187 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P93147.2|C81E1_GLYEC RecName: Full=Isoflavone 2'-hydroxylase;... 125 4e-27 dbj|BAA74465.1| cytochrome P450 [Glycyrrhiza echinata] 123 2e-26 gb|AAQ20040.1| isoflavone 2'-hydroxylase [Medicago truncatula] 116 2e-24 emb|CAA10067.1| cytochrome P450 [Cicer arietinum] 113 1e-23 emb|CAB41490.1| cytochrome P450 monooxygenase [Cicer arietinum] 113 1e-23 >sp|P93147.2|C81E1_GLYEC RecName: Full=Isoflavone 2'-hydroxylase; AltName: Full=CYP GE-3; AltName: Full=Cytochrome P450 81E1; AltName: Full=Cytochrome P450 91A4 gi|2443348|dbj|BAA22422.1| cytochrome P450 [Glycyrrhiza echinata] Length = 499 Score = 125 bits (314), Expect = 4e-27 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = +3 Query: 3 LSEKYGHVFSLWFGSRLVVVVSSASEFEQCFTKNDVVLANRPRFLSGKYIFYNYTTLGST 182 LSEKYGHVFSLWFGSRLVVVVSSASEF+QCFTKNDVVLANRPRFLSGKYIFYNYTTLGST Sbjct: 59 LSEKYGHVFSLWFGSRLVVVVSSASEFQQCFTKNDVVLANRPRFLSGKYIFYNYTTLGST 118 Query: 183 S 185 S Sbjct: 119 S 119 >dbj|BAA74465.1| cytochrome P450 [Glycyrrhiza echinata] Length = 499 Score = 123 bits (308), Expect = 2e-26 Identities = 59/61 (96%), Positives = 60/61 (98%) Frame = +3 Query: 3 LSEKYGHVFSLWFGSRLVVVVSSASEFEQCFTKNDVVLANRPRFLSGKYIFYNYTTLGST 182 LSEKYGHV SLWFGSRLVVVVSSASEF+QCFTKNDVVLANRPRFLSGKYIFYNYTTLGST Sbjct: 59 LSEKYGHVISLWFGSRLVVVVSSASEFQQCFTKNDVVLANRPRFLSGKYIFYNYTTLGST 118 Query: 183 S 185 S Sbjct: 119 S 119 >gb|AAQ20040.1| isoflavone 2'-hydroxylase [Medicago truncatula] Length = 498 Score = 116 bits (290), Expect = 2e-24 Identities = 55/61 (90%), Positives = 59/61 (96%) Frame = +3 Query: 3 LSEKYGHVFSLWFGSRLVVVVSSASEFEQCFTKNDVVLANRPRFLSGKYIFYNYTTLGST 182 L+EKYG+V SLWFGSRLVVVVSS SEF++CFTKNDVVLANRPRFLSGKYIFYNYTTLGST Sbjct: 59 LTEKYGNVISLWFGSRLVVVVSSLSEFQECFTKNDVVLANRPRFLSGKYIFYNYTTLGST 118 Query: 183 S 185 S Sbjct: 119 S 119 >emb|CAA10067.1| cytochrome P450 [Cicer arietinum] Length = 498 Score = 113 bits (283), Expect = 1e-23 Identities = 54/61 (88%), Positives = 57/61 (93%) Frame = +3 Query: 3 LSEKYGHVFSLWFGSRLVVVVSSASEFEQCFTKNDVVLANRPRFLSGKYIFYNYTTLGST 182 LS+ YG + SLWFGSRLVVVVSS SEF+QCFTKNDVVLANRPRFLSGKYIFYNYTTLGST Sbjct: 59 LSKTYGDIISLWFGSRLVVVVSSLSEFQQCFTKNDVVLANRPRFLSGKYIFYNYTTLGST 118 Query: 183 S 185 S Sbjct: 119 S 119 >emb|CAB41490.1| cytochrome P450 monooxygenase [Cicer arietinum] Length = 498 Score = 113 bits (283), Expect = 1e-23 Identities = 54/61 (88%), Positives = 57/61 (93%) Frame = +3 Query: 3 LSEKYGHVFSLWFGSRLVVVVSSASEFEQCFTKNDVVLANRPRFLSGKYIFYNYTTLGST 182 LS+ YG + SLWFGSRLVVVVSS SEF+QCFTKNDVVLANRPRFLSGKYIFYNYTTLGST Sbjct: 59 LSKTYGDIISLWFGSRLVVVVSSLSEFQQCFTKNDVVLANRPRFLSGKYIFYNYTTLGST 118 Query: 183 S 185 S Sbjct: 119 S 119