BLASTX nr result
ID: Glycyrrhiza23_contig00025901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00025901 (322 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003591223.1| Pentatricopeptide repeat-containing protein ... 72 6e-11 >ref|XP_003591223.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355480271|gb|AES61474.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 606 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = +2 Query: 188 MACGRKLLCPTDFRPIPLMVQNSLRCAQLNAPFSPKDLTGLSTDL 322 MAC RKLL T+FRPIP VQNSLRC Q + PF+PKDLTGL+TDL Sbjct: 3 MACSRKLLSSTNFRPIPFSVQNSLRCIQNDTPFNPKDLTGLTTDL 47