BLASTX nr result
ID: Glycyrrhiza23_contig00025852
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00025852 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003519948.1| PREDICTED: tyrosine-specific transport prote... 60 2e-07 >ref|XP_003519948.1| PREDICTED: tyrosine-specific transport protein-like [Glycine max] Length = 530 Score = 59.7 bits (143), Expect = 2e-07 Identities = 36/74 (48%), Positives = 46/74 (62%), Gaps = 1/74 (1%) Frame = +1 Query: 10 LHLSLPFNHKYHLTCQKLNGIVHFHGHRTHHLQTSVLVSNHKPTLSPLFTTNASNNLVPI 189 + LS P T QK+NG V+F GHRT HLQTS +K T++P+F TN SN P+ Sbjct: 1 MRLSQPLFRYKPFTSQKINGTVNFVGHRT-HLQTS-----YKKTVAPIFITNGSN--APL 52 Query: 190 -KKIAPCNAIAFPS 228 K+APCNAI P+ Sbjct: 53 TTKLAPCNAITLPT 66