BLASTX nr result
ID: Glycyrrhiza23_contig00025754
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00025754 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003532697.1| PREDICTED: pentatricopeptide repeat-containi... 118 4e-25 ref|XP_002283361.1| PREDICTED: pentatricopeptide repeat-containi... 80 1e-13 ref|XP_002523384.1| pentatricopeptide repeat-containing protein,... 60 1e-07 ref|XP_003525660.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 >ref|XP_003532697.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Glycine max] Length = 444 Score = 118 bits (296), Expect = 4e-25 Identities = 55/72 (76%), Positives = 61/72 (84%) Frame = +1 Query: 79 PYLISQFLLSACSISLPFAISFFHSLPILPPLFAWNTIIRALANTPTPLESLALFRRLQS 258 P+ ISQFLL + +ISLPFA SFFHSLP LPPLFAWNT+IRA A TPTP SL LFR LQ+ Sbjct: 32 PFFISQFLLQSSTISLPFAASFFHSLPTLPPLFAWNTLIRAFAATPTPFHSLTLFRLLQT 91 Query: 259 SPLSPDNFTYPF 294 SPL+PDNFTYPF Sbjct: 92 SPLNPDNFTYPF 103 >ref|XP_002283361.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36730 [Vitis vinifera] Length = 461 Score = 80.5 bits (197), Expect = 1e-13 Identities = 38/72 (52%), Positives = 49/72 (68%) Frame = +1 Query: 79 PYLISQFLLSACSISLPFAISFFHSLPILPPLFAWNTIIRALANTPTPLESLALFRRLQS 258 P LISQF+ S S+S+ FA F LPI P+FAWN+IIRA + P+E++ LF ++Q Sbjct: 34 PDLISQFIFSISSVSIEFARLVFDRLPIRAPIFAWNSIIRAYTKSSVPIEAVKLFSQMQR 93 Query: 259 SPLSPDNFTYPF 294 L PDNFTYPF Sbjct: 94 VGLKPDNFTYPF 105 >ref|XP_002523384.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223537334|gb|EEF38963.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 538 Score = 60.5 bits (145), Expect = 1e-07 Identities = 32/71 (45%), Positives = 48/71 (67%), Gaps = 1/71 (1%) Frame = +1 Query: 85 LISQFLLSACSISLP-FAISFFHSLPILPPLFAWNTIIRALANTPTPLESLALFRRLQSS 261 L+S F+ S+ S+ +A S F SL P +F +NTIIRAL+ +P P S+ LF R+QS+ Sbjct: 45 LLSLFIQSSSSLGFSLYAYSLFTSLTHPPNIFLYNTIIRALSLSPQPSLSIFLFNRIQSA 104 Query: 262 PLSPDNFTYPF 294 L PD++++PF Sbjct: 105 RLRPDSYSFPF 115 >ref|XP_003525660.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Glycine max] Length = 736 Score = 58.5 bits (140), Expect = 5e-07 Identities = 31/69 (44%), Positives = 45/69 (65%), Gaps = 5/69 (7%) Frame = +1 Query: 100 LLSACSIS----LPFAISFFHSLPILPP-LFAWNTIIRALANTPTPLESLALFRRLQSSP 264 L+ C++S L +A+S FHS+ PP +F WNT+IRA + TPTP SL LF ++ S Sbjct: 63 LIEFCALSPSRDLSYALSLFHSIHHQPPNIFIWNTLIRAHSLTPTPTSSLHLFSQMLHSG 122 Query: 265 LSPDNFTYP 291 L P++ T+P Sbjct: 123 LYPNSHTFP 131