BLASTX nr result
ID: Glycyrrhiza23_contig00025752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00025752 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003525681.1| PREDICTED: NAC domain-containing protein 8-l... 58 7e-07 ref|XP_003554828.1| PREDICTED: NAC domain-containing protein 8-l... 57 1e-06 ref|XP_003548560.1| PREDICTED: NAC domain-containing protein 8-l... 55 8e-06 >ref|XP_003525681.1| PREDICTED: NAC domain-containing protein 8-like [Glycine max] Length = 433 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/41 (65%), Positives = 32/41 (78%), Gaps = 2/41 (4%) Frame = +2 Query: 53 ENDNASYGISVLDTLELDTPPEFDLSNLP--QDSSILEWLD 169 +ND ASYG+SVLDTLE DTPP+FDLSNL S L+W+D Sbjct: 391 DNDYASYGVSVLDTLEFDTPPDFDLSNLQFGSQDSTLQWID 431 >ref|XP_003554828.1| PREDICTED: NAC domain-containing protein 8-like [Glycine max] Length = 429 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/40 (67%), Positives = 31/40 (77%), Gaps = 2/40 (5%) Frame = +2 Query: 56 NDNASYGISVLDTLELDTPPEFDLSNLP--QDSSILEWLD 169 ND SYG+SVLDTLELDTPP+FDLSNL S L+W+D Sbjct: 388 NDYGSYGVSVLDTLELDTPPDFDLSNLQFGSQDSTLQWID 427 >ref|XP_003548560.1| PREDICTED: NAC domain-containing protein 8-like [Glycine max] Length = 592 Score = 54.7 bits (130), Expect = 8e-06 Identities = 30/56 (53%), Positives = 38/56 (67%), Gaps = 3/56 (5%) Frame = +2 Query: 11 STVDGFACNVNEFGENDNASYGISVLDTLELDTPPEFDLSNL---PQDSSILEWLD 169 + +D A + NDN GIS+LDTLELDT P+FDLS+L QDSSIL+W+D Sbjct: 343 TNLDDIASYATQRARNDNEPCGISLLDTLELDT-PDFDLSSLYFCSQDSSILDWMD 397