BLASTX nr result
ID: Glycyrrhiza23_contig00025546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00025546 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003543765.1| PREDICTED: TPR repeat-containing thioredoxin... 137 9e-31 ref|XP_003544787.1| PREDICTED: TPR repeat-containing thioredoxin... 134 8e-30 ref|XP_003527909.1| PREDICTED: TPR repeat-containing thioredoxin... 132 3e-29 ref|XP_003615062.1| Small glutamine-rich tetratricopeptide repea... 132 3e-29 ref|XP_003523822.1| PREDICTED: TPR repeat-containing thioredoxin... 130 9e-29 >ref|XP_003543765.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] Length = 703 Score = 137 bits (345), Expect = 9e-31 Identities = 68/71 (95%), Positives = 70/71 (98%) Frame = +1 Query: 4 THKQVLLVLEQTSKRFPSVNFLKVEIEDHPYLAKSEGVSAIPAFKIYKNGSRVKEISGNN 183 THK+VLLVLEQ SKRFPSVNFLKVEIEDHPYLAKSEGVS+IPAFKIYKNGSRVKEISGNN Sbjct: 631 THKKVLLVLEQISKRFPSVNFLKVEIEDHPYLAKSEGVSSIPAFKIYKNGSRVKEISGNN 690 Query: 184 HELLERSVKLY 216 HELLERSVKLY Sbjct: 691 HELLERSVKLY 701 >ref|XP_003544787.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] Length = 694 Score = 134 bits (337), Expect = 8e-30 Identities = 67/72 (93%), Positives = 69/72 (95%) Frame = +1 Query: 1 ATHKQVLLVLEQTSKRFPSVNFLKVEIEDHPYLAKSEGVSAIPAFKIYKNGSRVKEISGN 180 ATHK+VLLVLEQ SKRFPSVNFLKVEIEDHPYLAKSE VS+IPAFKIYKNGS VKEISGN Sbjct: 621 ATHKKVLLVLEQISKRFPSVNFLKVEIEDHPYLAKSESVSSIPAFKIYKNGSSVKEISGN 680 Query: 181 NHELLERSVKLY 216 NHELLERSVKLY Sbjct: 681 NHELLERSVKLY 692 >ref|XP_003527909.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] Length = 698 Score = 132 bits (332), Expect = 3e-29 Identities = 64/72 (88%), Positives = 68/72 (94%) Frame = +1 Query: 1 ATHKQVLLVLEQTSKRFPSVNFLKVEIEDHPYLAKSEGVSAIPAFKIYKNGSRVKEISGN 180 ATHKQVLLVLEQT KRFPSVNFLKVEIEDHPYLAKSEGV+ IPAFKIYKNGSR+KEI GN Sbjct: 625 ATHKQVLLVLEQTCKRFPSVNFLKVEIEDHPYLAKSEGVNCIPAFKIYKNGSRIKEIPGN 684 Query: 181 NHELLERSVKLY 216 NH+LLE+ VKLY Sbjct: 685 NHDLLEKLVKLY 696 >ref|XP_003615062.1| Small glutamine-rich tetratricopeptide repeat-containing protein [Medicago truncatula] gi|355516397|gb|AES98020.1| Small glutamine-rich tetratricopeptide repeat-containing protein [Medicago truncatula] Length = 676 Score = 132 bits (332), Expect = 3e-29 Identities = 64/71 (90%), Positives = 67/71 (94%) Frame = +1 Query: 4 THKQVLLVLEQTSKRFPSVNFLKVEIEDHPYLAKSEGVSAIPAFKIYKNGSRVKEISGNN 183 THKQV +VLEQTSKRFPSVNFLKVEIEDHPYLAKSEGVS+ PAFKIYKNGSRVKEISGNN Sbjct: 604 THKQVSMVLEQTSKRFPSVNFLKVEIEDHPYLAKSEGVSSFPAFKIYKNGSRVKEISGNN 663 Query: 184 HELLERSVKLY 216 HE LE+SVK Y Sbjct: 664 HEFLEKSVKFY 674 >ref|XP_003523822.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] Length = 654 Score = 130 bits (328), Expect = 9e-29 Identities = 64/72 (88%), Positives = 68/72 (94%) Frame = +1 Query: 1 ATHKQVLLVLEQTSKRFPSVNFLKVEIEDHPYLAKSEGVSAIPAFKIYKNGSRVKEISGN 180 ATHKQVLLVLEQT KRFPSVNFLKVEIEDHPYLAKSEGV+ IPAFKIYKNGSRVKEI G+ Sbjct: 581 ATHKQVLLVLEQTCKRFPSVNFLKVEIEDHPYLAKSEGVNCIPAFKIYKNGSRVKEIPGS 640 Query: 181 NHELLERSVKLY 216 NH+LLE+ VKLY Sbjct: 641 NHDLLEKLVKLY 652