BLASTX nr result
ID: Glycyrrhiza23_contig00025504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00025504 (377 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003538267.1| PREDICTED: E3 ubiquitin-protein ligase KEG-l... 89 4e-16 ref|XP_003522897.1| PREDICTED: E3 ubiquitin-protein ligase KEG-l... 89 4e-16 ref|XP_003598471.1| A subunit of NADH dehydrogenase [Medicago tr... 88 8e-16 ref|XP_002513030.1| ankyrin-repeat containing protein, putative ... 87 1e-15 ref|XP_002263469.1| PREDICTED: E3 ubiquitin-protein ligase KEG [... 84 9e-15 >ref|XP_003538267.1| PREDICTED: E3 ubiquitin-protein ligase KEG-like [Glycine max] Length = 1637 Score = 89.0 bits (219), Expect = 4e-16 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 264 MKIPCCSVCQTRYNEEERVPLLLQCGHGFCRECLSRMF 377 MKIPCCSVCQTRYNEEERVPLLLQCGHGFCRECLSRMF Sbjct: 1 MKIPCCSVCQTRYNEEERVPLLLQCGHGFCRECLSRMF 38 >ref|XP_003522897.1| PREDICTED: E3 ubiquitin-protein ligase KEG-like [Glycine max] Length = 1642 Score = 89.0 bits (219), Expect = 4e-16 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 264 MKIPCCSVCQTRYNEEERVPLLLQCGHGFCRECLSRMF 377 MKIPCCSVCQTRYNEEERVPLLLQCGHGFCRECLSRMF Sbjct: 1 MKIPCCSVCQTRYNEEERVPLLLQCGHGFCRECLSRMF 38 >ref|XP_003598471.1| A subunit of NADH dehydrogenase [Medicago truncatula] gi|355487519|gb|AES68722.1| A subunit of NADH dehydrogenase [Medicago truncatula] Length = 1819 Score = 87.8 bits (216), Expect = 8e-16 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +3 Query: 264 MKIPCCSVCQTRYNEEERVPLLLQCGHGFCRECLSRMF 377 MKIPCCSVCQTRYNEEERVPLLLQCGHGFC+ECLSRMF Sbjct: 1 MKIPCCSVCQTRYNEEERVPLLLQCGHGFCKECLSRMF 38 >ref|XP_002513030.1| ankyrin-repeat containing protein, putative [Ricinus communis] gi|223548041|gb|EEF49533.1| ankyrin-repeat containing protein, putative [Ricinus communis] Length = 1617 Score = 87.4 bits (215), Expect = 1e-15 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +3 Query: 264 MKIPCCSVCQTRYNEEERVPLLLQCGHGFCRECLSRMF 377 MK+PCCSVCQTRYNEEERVPLLLQCGHGFC+ECLSRMF Sbjct: 1 MKVPCCSVCQTRYNEEERVPLLLQCGHGFCKECLSRMF 38 >ref|XP_002263469.1| PREDICTED: E3 ubiquitin-protein ligase KEG [Vitis vinifera] gi|296087851|emb|CBI35107.3| unnamed protein product [Vitis vinifera] Length = 1631 Score = 84.3 bits (207), Expect = 9e-15 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +3 Query: 264 MKIPCCSVCQTRYNEEERVPLLLQCGHGFCRECLSRMF 377 MKIPCC VCQTRYNEEERVPLLLQCGHGFC+ECLSR+F Sbjct: 1 MKIPCCLVCQTRYNEEERVPLLLQCGHGFCKECLSRLF 38