BLASTX nr result
ID: Glycyrrhiza23_contig00025092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00025092 (384 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003545137.1| PREDICTED: uncharacterized protein LOC100800... 92 6e-17 ref|XP_003617459.1| hypothetical protein MTR_5g091810 [Medicago ... 89 5e-16 >ref|XP_003545137.1| PREDICTED: uncharacterized protein LOC100800669 [Glycine max] Length = 1386 Score = 91.7 bits (226), Expect = 6e-17 Identities = 39/54 (72%), Positives = 46/54 (85%) Frame = -3 Query: 331 IMGAAFDGFSIRDYTSKMRSVDVFKCWPFTSAINREVTRDEVQSWLPPMTLCPR 170 ++ A FDGFSIRDYTSKMRS+DVFKCWPF S +R+V+ +EVQSWLPPM CPR Sbjct: 1 MVAATFDGFSIRDYTSKMRSIDVFKCWPFASTSSRDVSDEEVQSWLPPMNPCPR 54 >ref|XP_003617459.1| hypothetical protein MTR_5g091810 [Medicago truncatula] gi|355518794|gb|AET00418.1| hypothetical protein MTR_5g091810 [Medicago truncatula] Length = 1378 Score = 88.6 bits (218), Expect = 5e-16 Identities = 37/52 (71%), Positives = 44/52 (84%) Frame = -3 Query: 328 MGAAFDGFSIRDYTSKMRSVDVFKCWPFTSAINREVTRDEVQSWLPPMTLCP 173 M + FDGFSIR+YTSKMRS+DVFKCWPFTS N +TRD++ SWLPPM+ CP Sbjct: 1 MDSRFDGFSIREYTSKMRSIDVFKCWPFTSTSNPHLTRDQLHSWLPPMSPCP 52