BLASTX nr result
ID: Glycyrrhiza23_contig00024928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00024928 (505 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003600809.1| Guanylyl cyclase [Medicago truncatula] gi|35... 88 8e-16 ref|XP_003538434.1| PREDICTED: uncharacterized protein C22orf13 ... 79 5e-13 ref|NP_001236262.1| guanylyl cyclase [Glycine max] gi|116668552|... 79 5e-13 >ref|XP_003600809.1| Guanylyl cyclase [Medicago truncatula] gi|355489857|gb|AES71060.1| Guanylyl cyclase [Medicago truncatula] Length = 425 Score = 87.8 bits (216), Expect = 8e-16 Identities = 43/52 (82%), Positives = 44/52 (84%) Frame = -1 Query: 157 MWPIYLLFNKILKTEDERELKAENLSVIDPYLFQQSSSNIDSHPHSLRRSLF 2 MWPI LLFNKILKTEDERELK ENLS I+ YLFQ SS N DSHP SLRRSLF Sbjct: 1 MWPICLLFNKILKTEDERELKGENLSTIESYLFQHSSCNTDSHPPSLRRSLF 52 >ref|XP_003538434.1| PREDICTED: uncharacterized protein C22orf13 homolog [Glycine max] Length = 282 Score = 78.6 bits (192), Expect = 5e-13 Identities = 39/52 (75%), Positives = 41/52 (78%) Frame = -1 Query: 157 MWPIYLLFNKILKTEDERELKAENLSVIDPYLFQQSSSNIDSHPHSLRRSLF 2 MWPI LLFNKILK DE ELK +NL+ IDPYLFQQ S NIDSHP SLR S F Sbjct: 1 MWPICLLFNKILKAGDEGELKGDNLNAIDPYLFQQPSINIDSHPPSLRCSHF 52 >ref|NP_001236262.1| guanylyl cyclase [Glycine max] gi|116668552|gb|ABK15530.1| guanylyl cyclase [Glycine max] Length = 281 Score = 78.6 bits (192), Expect = 5e-13 Identities = 39/52 (75%), Positives = 41/52 (78%) Frame = -1 Query: 157 MWPIYLLFNKILKTEDERELKAENLSVIDPYLFQQSSSNIDSHPHSLRRSLF 2 MWPI LLFNKILK DE ELK +NL+ IDPYLFQQ S NIDSHP SLR S F Sbjct: 1 MWPICLLFNKILKAGDEGELKGDNLNAIDPYLFQQPSINIDSHPPSLRCSHF 52