BLASTX nr result
ID: Glycyrrhiza23_contig00024541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00024541 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003531467.1| PREDICTED: pentatricopeptide repeat-containi... 98 8e-19 ref|XP_003533538.1| PREDICTED: pentatricopeptide repeat-containi... 94 9e-18 ref|XP_002322250.1| predicted protein [Populus trichocarpa] gi|2... 91 7e-17 emb|CBI15662.3| unnamed protein product [Vitis vinifera] 91 1e-16 ref|XP_002280013.1| PREDICTED: pentatricopeptide repeat-containi... 91 1e-16 >ref|XP_003531467.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Glycine max] Length = 691 Score = 97.8 bits (242), Expect = 8e-19 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = +3 Query: 3 QGHRVCGNCHNAIKLIAKVTGREIVLRDASRFHHFKNGSCSCGDYW 140 QGHRVCG+CH+AIKLIA VTGREIV+RDASRFHHF+NGSCSCGDYW Sbjct: 646 QGHRVCGDCHSAIKLIAMVTGREIVVRDASRFHHFRNGSCSCGDYW 691 >ref|XP_003533538.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Glycine max] Length = 690 Score = 94.4 bits (233), Expect = 9e-18 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +3 Query: 3 QGHRVCGNCHNAIKLIAKVTGREIVLRDASRFHHFKNGSCSCGDYW 140 QGHRVCG+CH+AIK IA VTGREIV+RDASRFHHF++GSCSCGDYW Sbjct: 645 QGHRVCGDCHSAIKFIAMVTGREIVVRDASRFHHFRDGSCSCGDYW 690 >ref|XP_002322250.1| predicted protein [Populus trichocarpa] gi|222869246|gb|EEF06377.1| predicted protein [Populus trichocarpa] Length = 548 Score = 91.3 bits (225), Expect = 7e-17 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = +3 Query: 3 QGHRVCGNCHNAIKLIAKVTGREIVLRDASRFHHFKNGSCSCGDYW 140 QGHR+CG+CH AIKLIA+VTGREIV+RDA RFHHFK+G CSC DYW Sbjct: 503 QGHRICGDCHEAIKLIARVTGREIVIRDAGRFHHFKHGHCSCEDYW 548 >emb|CBI15662.3| unnamed protein product [Vitis vinifera] Length = 657 Score = 90.9 bits (224), Expect = 1e-16 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +3 Query: 3 QGHRVCGNCHNAIKLIAKVTGREIVLRDASRFHHFKNGSCSCGDYW 140 Q HR+CG+CH+AIKLIA VT REIV+RDASRFHHFK+GSCSCGDYW Sbjct: 612 QSHRICGDCHSAIKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 657 >ref|XP_002280013.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Vitis vinifera] Length = 704 Score = 90.9 bits (224), Expect = 1e-16 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +3 Query: 3 QGHRVCGNCHNAIKLIAKVTGREIVLRDASRFHHFKNGSCSCGDYW 140 Q HR+CG+CH+AIKLIA VT REIV+RDASRFHHFK+GSCSCGDYW Sbjct: 659 QSHRICGDCHSAIKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 704