BLASTX nr result
ID: Glycyrrhiza23_contig00024304
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00024304 (524 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20340.3| unnamed protein product [Vitis vinifera] 55 6e-06 ref|XP_002282052.1| PREDICTED: WD repeat-containing protein 44-l... 55 6e-06 >emb|CBI20340.3| unnamed protein product [Vitis vinifera] Length = 749 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -3 Query: 489 NSYDIWISQPSSVSERRSRLLQTIGLSSDLSLSRVSNNA 373 + YDIWIS+PSS+ ERRSRLL+ +GLS+D SLSRV A Sbjct: 61 SKYDIWISEPSSIEERRSRLLREMGLSNDPSLSRVKPTA 99 >ref|XP_002282052.1| PREDICTED: WD repeat-containing protein 44-like [Vitis vinifera] Length = 880 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -3 Query: 489 NSYDIWISQPSSVSERRSRLLQTIGLSSDLSLSRVSNNA 373 + YDIWIS+PSS+ ERRSRLL+ +GLS+D SLSRV A Sbjct: 61 SKYDIWISEPSSIEERRSRLLREMGLSNDPSLSRVKPTA 99