BLASTX nr result
ID: Glycyrrhiza23_contig00024068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00024068 (657 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] g... 86 8e-15 ref|XP_002535311.1| conserved hypothetical protein [Ricinus comm... 50 1e-10 ref|XP_002531802.1| conserved hypothetical protein [Ricinus comm... 60 5e-07 >ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] gi|355477354|gb|AES58557.1| Ribosomal protein S3 [Medicago truncatula] Length = 306 Score = 85.5 bits (210), Expect = 8e-15 Identities = 46/64 (71%), Positives = 46/64 (71%) Frame = +1 Query: 448 MGQRIKRFYFVSRDSPQVGFESRVMGDYPARFGEHF*SALVNGSPSIKQERSGYSHGGVT 627 MGQRIKRF FVSRDSPQVGFESRVMGDYPARFGE SGYSHGGVT Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGE-----------------SGYSHGGVT 43 Query: 628 IDSI 639 IDSI Sbjct: 44 IDSI 47 >ref|XP_002535311.1| conserved hypothetical protein [Ricinus communis] gi|223523476|gb|EEF27072.1| conserved hypothetical protein [Ricinus communis] Length = 63 Score = 49.7 bits (117), Expect(2) = 1e-10 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -1 Query: 396 RDRLSFKPLSFGSNKSSPLGRFAQV 322 RDRLSFKPLSFGS+KSSP GRFAQV Sbjct: 10 RDRLSFKPLSFGSDKSSPFGRFAQV 34 Score = 42.4 bits (98), Expect(2) = 1e-10 Identities = 20/30 (66%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = -2 Query: 329 LRWSSLILS--NVQSCSGLKKEHRPSALNE 246 +RWSS + NV+SCSGL+KEHRPS LNE Sbjct: 34 VRWSSRSVGFPNVKSCSGLRKEHRPSTLNE 63 >ref|XP_002531802.1| conserved hypothetical protein [Ricinus communis] gi|223528568|gb|EEF30590.1| conserved hypothetical protein [Ricinus communis] Length = 72 Score = 59.7 bits (143), Expect = 5e-07 Identities = 34/59 (57%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = -1 Query: 591 LDRGASIHQRRLKVLSEPCWIVTHHTALKPNLW*-IPGDKVKALDPLPHTLRCFSPPIK 418 L RG SI Q RLKVL EPC I+T++T GD VKALDPLPHTL+ S PIK Sbjct: 14 LTRGPSIQQCRLKVLCEPCRIITYYTTHSSQTCDGSQGDNVKALDPLPHTLKGSSTPIK 72