BLASTX nr result
ID: Glycyrrhiza23_contig00023935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00023935 (220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN48988.1| type A response regulator RR1 [Phaseolus vulgaris] 55 6e-06 ref|XP_003517746.1| PREDICTED: two-component response regulator ... 55 8e-06 >gb|ABN48988.1| type A response regulator RR1 [Phaseolus vulgaris] Length = 227 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +1 Query: 103 METNGVVSFDVSPVCSSEEVHVLAVDDSLVDRKVIERLL 219 M+T+G+VSFD S EVHVLAVDDSLVDRKVIERLL Sbjct: 1 MDTDGLVSFDHISPEDSHEVHVLAVDDSLVDRKVIERLL 39 >ref|XP_003517746.1| PREDICTED: two-component response regulator ARR3-like [Glycine max] Length = 244 Score = 54.7 bits (130), Expect = 8e-06 Identities = 32/40 (80%), Positives = 35/40 (87%), Gaps = 1/40 (2%) Frame = +1 Query: 103 METNGVVSFD-VSPVCSSEEVHVLAVDDSLVDRKVIERLL 219 M+T+GVVSF+ VSP S EVHVLAVDDSLVDRKVIERLL Sbjct: 1 MDTDGVVSFNHVSPE-DSHEVHVLAVDDSLVDRKVIERLL 39