BLASTX nr result
ID: Glycyrrhiza23_contig00023909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00023909 (438 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003531326.1| PREDICTED: pentatricopeptide repeat-containi... 59 4e-07 ref|XP_002282301.1| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 >ref|XP_003531326.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Glycine max] Length = 521 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 6 ACRVWDQMMEKGLTLDSRLSETLVNAIQSSDG 101 ACRVWDQMME+G TL+ LSETLVNAIQSSDG Sbjct: 488 ACRVWDQMMERGFTLNRHLSETLVNAIQSSDG 519 >ref|XP_002282301.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Vitis vinifera] gi|296081374|emb|CBI16807.3| unnamed protein product [Vitis vinifera] Length = 519 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 6 ACRVWDQMMEKGLTLDSRLSETLVNAIQSSDGA 104 ACRVWDQMMEKG TLD +SETLVNAI S+D + Sbjct: 483 ACRVWDQMMEKGFTLDGAVSETLVNAIHSNDAS 515