BLASTX nr result
ID: Glycyrrhiza23_contig00023747
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00023747 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003637882.1| hypothetical protein MTR_104s0014 [Medicago ... 62 4e-08 >ref|XP_003637882.1| hypothetical protein MTR_104s0014 [Medicago truncatula] gi|355503817|gb|AES85020.1| hypothetical protein MTR_104s0014 [Medicago truncatula] Length = 339 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = -1 Query: 148 KEMPRREYDGGYSQGWTTSYTILESWCTLYLKKFVDQHNRVSEVFLELE 2 KE + DGGY++GWTTSYT +S CTL L+K+VD+H ++ EV LELE Sbjct: 3 KEDDESDDDGGYNKGWTTSYTTGDSTCTLDLEKYVDEHGKIREVCLELE 51