BLASTX nr result
ID: Glycyrrhiza23_contig00023476
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00023476 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003550768.1| PREDICTED: uncharacterized protein LOC100802... 92 3e-17 ref|XP_003622400.1| RING finger and CHY zinc finger domain-conta... 80 1e-13 >ref|XP_003550768.1| PREDICTED: uncharacterized protein LOC100802706 [Glycine max] Length = 1262 Score = 92.4 bits (228), Expect = 3e-17 Identities = 53/70 (75%), Positives = 57/70 (81%), Gaps = 4/70 (5%) Frame = +3 Query: 87 MDDGDPSLSDEE---NDVEDSPDNLSRVRLVDAPILLFVCFHKALRSELDRLRGLAETA- 254 MDDGDPSLSD+E ND ED+P L RV LVDAPILLFVCFHKA RSELD LR LAETA Sbjct: 1 MDDGDPSLSDKEEGENDEEDTP--LLRVPLVDAPILLFVCFHKAFRSELDHLRRLAETAS 58 Query: 255 SLQDDPRRRR 284 SL+D+PRR R Sbjct: 59 SLEDEPRRCR 68 >ref|XP_003622400.1| RING finger and CHY zinc finger domain-containing protein [Medicago truncatula] gi|355497415|gb|AES78618.1| RING finger and CHY zinc finger domain-containing protein [Medicago truncatula] Length = 1225 Score = 80.5 bits (197), Expect = 1e-13 Identities = 49/74 (66%), Positives = 53/74 (71%), Gaps = 8/74 (10%) Frame = +3 Query: 87 MDDGDPSLSD-----EENDV--EDSPDNLSRVRLVDAPILLFVCFHKALRSELDRLRGLA 245 M GDPSLSD EENDV DS D LSR + DAPILLFVCFH+ALRSELD+LR A Sbjct: 1 MGGGDPSLSDMEEEEEENDVMVNDSVDILSRFPIFDAPILLFVCFHQALRSELDQLRPFA 60 Query: 246 ETA-SLQDDPRRRR 284 ETA SL+ DP R R Sbjct: 61 ETASSLEHDPNRCR 74