BLASTX nr result
ID: Glycyrrhiza23_contig00023322
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00023322 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003605655.1| Ethylene-responsive transcription factor [Me... 67 1e-09 ref|XP_003534428.1| PREDICTED: dehydration-responsive element-bi... 65 6e-09 >ref|XP_003605655.1| Ethylene-responsive transcription factor [Medicago truncatula] gi|355506710|gb|AES87852.1| Ethylene-responsive transcription factor [Medicago truncatula] Length = 429 Score = 67.0 bits (162), Expect = 1e-09 Identities = 33/49 (67%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = +2 Query: 2 EYWDRFGEESLSTTPFQDAKDAPLMSPIRVGSTFGD-LAWNEVFNFNDD 145 E+W EE +STT F D +DAPLMSP RVGS FGD + WNEVFNFNDD Sbjct: 255 EWWKE--EECVSTTSFWDVEDAPLMSPTRVGSIFGDMMTWNEVFNFNDD 301 >ref|XP_003534428.1| PREDICTED: dehydration-responsive element-binding protein 3-like [Glycine max] Length = 164 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/47 (57%), Positives = 38/47 (80%) Frame = +2 Query: 29 SLSTTPFQDAKDAPLMSPIRVGSTFGDLAWNEVFNFNDDILAIASTA 169 S +T+ F D +APLMSP+RV STFGD +W+++F+FNDDIL + ST+ Sbjct: 113 STTTSSFHDVMEAPLMSPLRVDSTFGDFSWDQLFDFNDDILIVGSTS 159