BLASTX nr result
ID: Glycyrrhiza23_contig00023231
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00023231 (296 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003592540.1| Pentatricopeptide repeat-containing protein ... 75 4e-12 ref|XP_003535704.1| PREDICTED: pentatricopeptide repeat-containi... 69 4e-10 >ref|XP_003592540.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355481588|gb|AES62791.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 507 Score = 75.5 bits (184), Expect = 4e-12 Identities = 46/78 (58%), Positives = 52/78 (66%), Gaps = 1/78 (1%) Frame = +2 Query: 65 YSTPTVQLAQNSYGSLNKTHASAFHTSHA-EPNTNTNPDAERICKILSSRPNSSVDVSLG 241 + +PTVQ QN SL K H FHTS +PN NP AE IC+ILS+ P S VDVSL Sbjct: 23 FESPTVQFIQNPSRSL-KFHIFPFHTSLLHKPN---NPHAETICRILSTTPESPVDVSLR 78 Query: 242 DLPAEVSPELVVEVLNKL 295 + P EVSPELVV VLNKL Sbjct: 79 NFPVEVSPELVVAVLNKL 96 >ref|XP_003535704.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, mitochondrial-like [Glycine max] Length = 507 Score = 68.9 bits (167), Expect = 4e-10 Identities = 37/75 (49%), Positives = 47/75 (62%) Frame = +2 Query: 71 TPTVQLAQNSYGSLNKTHASAFHTSHAEPNTNTNPDAERICKILSSRPNSSVDVSLGDLP 250 +PT + +KTH AFHT+ P PDAE IC+ILS+ P S+VD L +P Sbjct: 26 SPTSVFDHHHSNGPSKTHTLAFHTAQPRPT----PDAEAICRILSTTPASTVDACLAAVP 81 Query: 251 AEVSPELVVEVLNKL 295 A+ SPELV+EVLNKL Sbjct: 82 AKPSPELVLEVLNKL 96