BLASTX nr result
ID: Glycyrrhiza23_contig00023229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00023229 (627 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003609981.1| Leucine-rich repeat receptor-like protein ki... 120 3e-25 ref|XP_003551100.1| PREDICTED: probable inactive leucine-rich re... 117 2e-24 ref|XP_003541314.1| PREDICTED: probable inactive leucine-rich re... 117 2e-24 ref|XP_003595340.1| Leucine-rich repeat receptor-like protein ki... 102 7e-20 ref|XP_003547509.1| PREDICTED: probable inactive leucine-rich re... 91 2e-16 >ref|XP_003609981.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula] gi|355511036|gb|AES92178.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula] Length = 627 Score = 120 bits (300), Expect = 3e-25 Identities = 61/67 (91%), Positives = 63/67 (94%) Frame = -2 Query: 626 DVVQWVFTAISERREAELIDPELTSNNTSSINQMLQLLQIGAASTESNPEQRLNMKEAIR 447 DVVQWVFTAISERREAELIDPELT+NN SIN MLQLLQIGAA TESNPEQRLNMKEAIR Sbjct: 561 DVVQWVFTAISERREAELIDPELTANNQDSINHMLQLLQIGAACTESNPEQRLNMKEAIR 620 Query: 446 RIEEVQV 426 RIEE+QV Sbjct: 621 RIEELQV 627 >ref|XP_003551100.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At5g20690-like [Glycine max] Length = 609 Score = 117 bits (292), Expect = 2e-24 Identities = 58/67 (86%), Positives = 64/67 (95%) Frame = -2 Query: 626 DVVQWVFTAISERREAELIDPELTSNNTSSINQMLQLLQIGAASTESNPEQRLNMKEAIR 447 DVV WVFTAISERREAELIDPEL SN+++S+NQMLQLLQ+GAA TESNP+QRLNMKEAIR Sbjct: 543 DVVHWVFTAISERREAELIDPELMSNHSNSLNQMLQLLQVGAACTESNPDQRLNMKEAIR 602 Query: 446 RIEEVQV 426 RIEEVQV Sbjct: 603 RIEEVQV 609 >ref|XP_003541314.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At5g20690-like [Glycine max] Length = 606 Score = 117 bits (292), Expect = 2e-24 Identities = 58/67 (86%), Positives = 64/67 (95%) Frame = -2 Query: 626 DVVQWVFTAISERREAELIDPELTSNNTSSINQMLQLLQIGAASTESNPEQRLNMKEAIR 447 DVV WVFTAISERREAELIDPEL SN+++S+NQMLQLLQ+GAA TESNP+QRLNMKEAIR Sbjct: 540 DVVHWVFTAISERREAELIDPELMSNHSNSLNQMLQLLQVGAACTESNPDQRLNMKEAIR 599 Query: 446 RIEEVQV 426 RIEEVQV Sbjct: 600 RIEEVQV 606 >ref|XP_003595340.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula] gi|355484388|gb|AES65591.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula] Length = 630 Score = 102 bits (253), Expect = 7e-20 Identities = 52/67 (77%), Positives = 58/67 (86%) Frame = -2 Query: 626 DVVQWVFTAISERREAELIDPELTSNNTSSINQMLQLLQIGAASTESNPEQRLNMKEAIR 447 DVVQWV TAISERREAELIDPEL +N ++ + MLQLL IGAA TESNPEQRL+MKEAIR Sbjct: 564 DVVQWVLTAISERREAELIDPELKNNASNKTSNMLQLLLIGAACTESNPEQRLHMKEAIR 623 Query: 446 RIEEVQV 426 RIEE Q+ Sbjct: 624 RIEEAQL 630 >ref|XP_003547509.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At5g20690-like [Glycine max] Length = 615 Score = 90.5 bits (223), Expect = 2e-16 Identities = 49/67 (73%), Positives = 52/67 (77%) Frame = -2 Query: 626 DVVQWVFTAISERREAELIDPELTSNNTSSINQMLQLLQIGAASTESNPEQRLNMKEAIR 447 DVVQW FTAISE EAELID EL N+ +S ML LL IGA ESNPEQRLNMKEA+R Sbjct: 550 DVVQWAFTAISEGTEAELIDSELP-NDANSRKNMLHLLHIGACCAESNPEQRLNMKEAVR 608 Query: 446 RIEEVQV 426 RIEEVQV Sbjct: 609 RIEEVQV 615