BLASTX nr result
ID: Glycyrrhiza23_contig00023176
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00023176 (459 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003547346.1| PREDICTED: uncharacterized protein LOC100805... 57 2e-06 >ref|XP_003547346.1| PREDICTED: uncharacterized protein LOC100805847 [Glycine max] Length = 63 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = -3 Query: 415 SQVHVAETSLSGPIEHLFHLPNERNHWNTAPKYKHLQCH 299 S VH AETSL+ PI HLFH NERNHW PK + QCH Sbjct: 25 SLVHFAETSLTFPINHLFHPVNERNHWKKDPKPRFFQCH 63