BLASTX nr result
ID: Glycyrrhiza23_contig00023173
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00023173 (688 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522897.1| conserved hypothetical protein [Ricinus comm... 56 8e-06 >ref|XP_002522897.1| conserved hypothetical protein [Ricinus communis] gi|223537882|gb|EEF39497.1| conserved hypothetical protein [Ricinus communis] Length = 235 Score = 55.8 bits (133), Expect = 8e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 262 ELANTDELNRKFEEFIRKMKEEMRIEAQRQPIAV 363 EL NT+ELNR+ EEFIRKMKEE+RIEAQ+Q IAV Sbjct: 202 ELTNTEELNRRIEEFIRKMKEEIRIEAQQQLIAV 235