BLASTX nr result
ID: Glycyrrhiza23_contig00023157
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00023157 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC86897.1| allene oxide synthase [Medicago truncatula] 46 9e-06 >emb|CAC86897.1| allene oxide synthase [Medicago truncatula] Length = 524 Score = 46.2 bits (108), Expect(3) = 9e-06 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -2 Query: 201 PLHRPNPNVVVVLLDGKSFPVLFDGTKVDKT 109 P NPNVVV LLDGKSFPVLFD +K+DKT Sbjct: 111 PFIAQNPNVVV-LLDGKSFPVLFDASKIDKT 140 Score = 25.4 bits (54), Expect(3) = 9e-06 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = -1 Query: 244 LDYFYNQGRE 215 LDYFYNQGR+ Sbjct: 79 LDYFYNQGRD 88 Score = 21.6 bits (44), Expect(3) = 9e-06 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -3 Query: 215 NMPPGPFI 192 N+PPGPFI Sbjct: 106 NVPPGPFI 113