BLASTX nr result
ID: Glycyrrhiza23_contig00023062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00023062 (414 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003600971.1| Multiple inositol polyphosphate phosphatase ... 57 2e-06 >ref|XP_003600971.1| Multiple inositol polyphosphate phosphatase [Medicago truncatula] gi|355490019|gb|AES71222.1| Multiple inositol polyphosphate phosphatase [Medicago truncatula] Length = 575 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = +3 Query: 3 HDYDTVCNAKLEQKPSGNTFFQMFQWFFPLGKDMST 110 HDYDTVCNAKLE K S + FQ+FQW FPL K ++T Sbjct: 537 HDYDTVCNAKLEPKSSRSMIFQIFQWLFPLAKGINT 572