BLASTX nr result
ID: Glycyrrhiza23_contig00022598
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00022598 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003536111.1| PREDICTED: serine/threonine-protein kinase W... 142 4e-32 ref|NP_001235958.1| with no lysine kinase 1 [Glycine max] gi|225... 142 4e-32 ref|XP_002328357.1| predicted protein [Populus trichocarpa] gi|2... 142 4e-32 ref|XP_003591018.1| With no lysine kinase [Medicago truncatula] ... 140 8e-32 ref|XP_002512245.1| kinase, putative [Ricinus communis] gi|22354... 140 1e-31 >ref|XP_003536111.1| PREDICTED: serine/threonine-protein kinase WNK1-like [Glycine max] Length = 708 Score = 142 bits (357), Expect = 4e-32 Identities = 65/66 (98%), Positives = 66/66 (100%) Frame = -3 Query: 199 HAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCILEMVTFEYPYSECTHPAQIYKKVISG 20 HAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCILEMVTFEYPYSECTHPAQIYKKVISG Sbjct: 182 HAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCILEMVTFEYPYSECTHPAQIYKKVISG 241 Query: 19 KKPEAL 2 KKP+AL Sbjct: 242 KKPDAL 247 >ref|NP_001235958.1| with no lysine kinase 1 [Glycine max] gi|225348631|gb|ACN87277.1| with no lysine kinase [Glycine max] Length = 698 Score = 142 bits (357), Expect = 4e-32 Identities = 65/66 (98%), Positives = 66/66 (100%) Frame = -3 Query: 199 HAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCILEMVTFEYPYSECTHPAQIYKKVISG 20 HAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCILEMVTFEYPYSECTHPAQIYKKVISG Sbjct: 182 HAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCILEMVTFEYPYSECTHPAQIYKKVISG 241 Query: 19 KKPEAL 2 KKP+AL Sbjct: 242 KKPDAL 247 >ref|XP_002328357.1| predicted protein [Populus trichocarpa] gi|222838072|gb|EEE76437.1| predicted protein [Populus trichocarpa] Length = 485 Score = 142 bits (357), Expect = 4e-32 Identities = 65/66 (98%), Positives = 66/66 (100%) Frame = -3 Query: 199 HAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCILEMVTFEYPYSECTHPAQIYKKVISG 20 HAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCILEMVTFEYPYSECTHPAQIYKKVISG Sbjct: 169 HAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCILEMVTFEYPYSECTHPAQIYKKVISG 228 Query: 19 KKPEAL 2 KKP+AL Sbjct: 229 KKPDAL 234 >ref|XP_003591018.1| With no lysine kinase [Medicago truncatula] gi|355480066|gb|AES61269.1| With no lysine kinase [Medicago truncatula] Length = 742 Score = 140 bits (354), Expect = 8e-32 Identities = 64/66 (96%), Positives = 66/66 (100%) Frame = -3 Query: 199 HAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCILEMVTFEYPYSECTHPAQIYKKVISG 20 HAAHCVGTPEFMAPEVYEE+YNELVDIYSFGMCILEMVTFEYPYSECTHPAQIYKKVISG Sbjct: 182 HAAHCVGTPEFMAPEVYEESYNELVDIYSFGMCILEMVTFEYPYSECTHPAQIYKKVISG 241 Query: 19 KKPEAL 2 KKP+AL Sbjct: 242 KKPDAL 247 >ref|XP_002512245.1| kinase, putative [Ricinus communis] gi|223548206|gb|EEF49697.1| kinase, putative [Ricinus communis] Length = 775 Score = 140 bits (353), Expect = 1e-31 Identities = 63/66 (95%), Positives = 66/66 (100%) Frame = -3 Query: 199 HAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCILEMVTFEYPYSECTHPAQIYKKVISG 20 HAAHCVGTPEFMAPEVYEEAYNELVD+YSFGMCILEMVTFEYPYSECTHPAQIYKKVISG Sbjct: 183 HAAHCVGTPEFMAPEVYEEAYNELVDVYSFGMCILEMVTFEYPYSECTHPAQIYKKVISG 242 Query: 19 KKPEAL 2 +KP+AL Sbjct: 243 RKPDAL 248