BLASTX nr result
ID: Glycyrrhiza23_contig00022593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00022593 (251 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003618091.1| Pentatricopeptide repeat-containing protein ... 125 5e-27 ref|XP_003518581.1| PREDICTED: pentatricopeptide repeat-containi... 112 2e-23 ref|XP_002520572.1| pentatricopeptide repeat-containing protein,... 93 2e-17 ref|XP_004167803.1| PREDICTED: pentatricopeptide repeat-containi... 90 2e-16 ref|XP_004146067.1| PREDICTED: pentatricopeptide repeat-containi... 90 2e-16 >ref|XP_003618091.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355519426|gb|AET01050.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 828 Score = 125 bits (313), Expect = 5e-27 Identities = 58/80 (72%), Positives = 69/80 (86%) Frame = -2 Query: 244 ALHAFASMIKHYVTPTAVTFVNLFPAVSKFGDSRVAHLFYGFLLKYGDEYVSDVFVVSSA 65 A+ AFA+MI V P+ VTFVNLFPA+SK GDSR +FYGF+ K+GD+YVSDVFVVSSA Sbjct: 205 AVEAFANMINQSVMPSPVTFVNLFPALSKLGDSRTVKMFYGFMRKFGDQYVSDVFVVSSA 264 Query: 64 ILMFADLGCVDYARMVFDRC 5 ILMF+D+GC+DYARMVFDRC Sbjct: 265 ILMFSDVGCMDYARMVFDRC 284 >ref|XP_003518581.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Glycine max] Length = 755 Score = 112 bits (281), Expect = 2e-23 Identities = 55/82 (67%), Positives = 66/82 (80%) Frame = -2 Query: 247 HALHAFASMIKHYVTPTAVTFVNLFPAVSKFGDSRVAHLFYGFLLKYGDEYVSDVFVVSS 68 HAL AFA++IK +TPT VTFVN+FPAV D + A +FY LLK+G +Y +DVF VSS Sbjct: 179 HALRAFATLIKTSITPTPVTFVNVFPAVP---DPKTALMFYALLLKFGADYANDVFAVSS 235 Query: 67 AILMFADLGCVDYARMVFDRCS 2 AI+MFADLGC+DYARMVFDRCS Sbjct: 236 AIVMFADLGCLDYARMVFDRCS 257 >ref|XP_002520572.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540232|gb|EEF41805.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 695 Score = 93.2 bits (230), Expect = 2e-17 Identities = 43/80 (53%), Positives = 59/80 (73%) Frame = -2 Query: 244 ALHAFASMIKHYVTPTAVTFVNLFPAVSKFGDSRVAHLFYGFLLKYGDEYVSDVFVVSSA 65 A+ F M+K + P+ V+FVN+FPA+S GD + A++ YG LLK G+EY +D+FVVSSA Sbjct: 84 AIRQFRLMMKWGIKPSPVSFVNVFPAISSVGDFKNANVLYGMLLKLGNEYANDLFVVSSA 143 Query: 64 ILMFADLGCVDYARMVFDRC 5 I M+A+LGC+D R VFD C Sbjct: 144 ISMYAELGCLDLCRKVFDSC 163 >ref|XP_004167803.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic-like [Cucumis sativus] Length = 817 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/80 (50%), Positives = 61/80 (76%) Frame = -2 Query: 244 ALHAFASMIKHYVTPTAVTFVNLFPAVSKFGDSRVAHLFYGFLLKYGDEYVSDVFVVSSA 65 A+ F+ M+K + P+ V+FVN+FPA S GD + A++ +G L+K G EYV+D++VVSSA Sbjct: 194 AVKQFSMMMKIGIKPSPVSFVNVFPAFSSLGDFKNANVVHGMLVKLGSEYVNDLYVVSSA 253 Query: 64 ILMFADLGCVDYARMVFDRC 5 I M+A+LGC+++A+ VFD C Sbjct: 254 IFMYAELGCLEFAKKVFDNC 273 >ref|XP_004146067.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic-like [Cucumis sativus] Length = 793 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/80 (50%), Positives = 61/80 (76%) Frame = -2 Query: 244 ALHAFASMIKHYVTPTAVTFVNLFPAVSKFGDSRVAHLFYGFLLKYGDEYVSDVFVVSSA 65 A+ F+ M+K + P+ V+FVN+FPA S GD + A++ +G L+K G EYV+D++VVSSA Sbjct: 170 AVKQFSMMMKIGIKPSPVSFVNVFPAFSSLGDFKNANVVHGMLVKLGSEYVNDLYVVSSA 229 Query: 64 ILMFADLGCVDYARMVFDRC 5 I M+A+LGC+++A+ VFD C Sbjct: 230 IFMYAELGCLEFAKKVFDNC 249