BLASTX nr result
ID: Glycyrrhiza23_contig00022521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00022521 (430 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003525917.1| PREDICTED: probable LRR receptor-like serine... 141 5e-32 ref|XP_003518219.1| PREDICTED: probable LRR receptor-like serine... 141 5e-32 ref|XP_003549546.1| PREDICTED: probable LRR receptor-like serine... 141 6e-32 ref|XP_002308399.1| predicted protein [Populus trichocarpa] gi|2... 140 1e-31 ref|XP_002532956.1| ATP binding protein, putative [Ricinus commu... 139 2e-31 >ref|XP_003525917.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230-like [Glycine max] Length = 856 Score = 141 bits (356), Expect = 5e-32 Identities = 73/82 (89%), Positives = 77/82 (93%) Frame = +1 Query: 1 KKPVGDDYPGDEKEATTLVSWVRGLVRKNKASGAIDPKIRDTGPEEQMEEALKIGYLCTA 180 KKPVGDDYP DEKEA+ LVSWVRGLVRKNKAS AIDPKIRDTG E QMEEALKIGYLCTA Sbjct: 775 KKPVGDDYP-DEKEAS-LVSWVRGLVRKNKASRAIDPKIRDTGAEVQMEEALKIGYLCTA 832 Query: 181 DLPSKRPSMQQVVGLLKDIEPT 246 DLPSKRPSMQQ+VGLLKDI+P+ Sbjct: 833 DLPSKRPSMQQIVGLLKDIKPS 854 >ref|XP_003518219.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230-like [Glycine max] Length = 854 Score = 141 bits (356), Expect = 5e-32 Identities = 72/82 (87%), Positives = 76/82 (92%) Frame = +1 Query: 1 KKPVGDDYPGDEKEATTLVSWVRGLVRKNKASGAIDPKIRDTGPEEQMEEALKIGYLCTA 180 K PVGDDYP D+KEAT LVSWVRGLVRKN+AS AIDPKI DTGP+EQMEEALKIGYLCTA Sbjct: 773 KMPVGDDYP-DDKEAT-LVSWVRGLVRKNQASRAIDPKIHDTGPDEQMEEALKIGYLCTA 830 Query: 181 DLPSKRPSMQQVVGLLKDIEPT 246 DLP KRPSMQQ+VGLLKDIEPT Sbjct: 831 DLPFKRPSMQQIVGLLKDIEPT 852 >ref|XP_003549546.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230-like [Glycine max] Length = 853 Score = 141 bits (355), Expect = 6e-32 Identities = 69/82 (84%), Positives = 76/82 (92%) Frame = +1 Query: 1 KKPVGDDYPGDEKEATTLVSWVRGLVRKNKASGAIDPKIRDTGPEEQMEEALKIGYLCTA 180 KKP+ DDYP D++E TLVSWVRGLVRKN+AS AIDPKIRDTGP+EQ+EEALKIGYLCTA Sbjct: 773 KKPIEDDYPDDKEE--TLVSWVRGLVRKNQASRAIDPKIRDTGPDEQIEEALKIGYLCTA 830 Query: 181 DLPSKRPSMQQVVGLLKDIEPT 246 DLP KRPSMQQ+VGLLKDIEPT Sbjct: 831 DLPFKRPSMQQIVGLLKDIEPT 852 >ref|XP_002308399.1| predicted protein [Populus trichocarpa] gi|222854375|gb|EEE91922.1| predicted protein [Populus trichocarpa] Length = 854 Score = 140 bits (352), Expect = 1e-31 Identities = 67/82 (81%), Positives = 76/82 (92%) Frame = +1 Query: 1 KKPVGDDYPGDEKEATTLVSWVRGLVRKNKASGAIDPKIRDTGPEEQMEEALKIGYLCTA 180 KKP+GDDYPG++ +TLVSWVRGLVRK++ S AIDPKIR+TGPE +MEEALKIGYLCTA Sbjct: 772 KKPIGDDYPGEKN--STLVSWVRGLVRKSQGSRAIDPKIRNTGPEREMEEALKIGYLCTA 829 Query: 181 DLPSKRPSMQQVVGLLKDIEPT 246 DLPSKRPSMQQ+VGLLKDIEPT Sbjct: 830 DLPSKRPSMQQIVGLLKDIEPT 851 >ref|XP_002532956.1| ATP binding protein, putative [Ricinus communis] gi|223527266|gb|EEF29422.1| ATP binding protein, putative [Ricinus communis] Length = 839 Score = 139 bits (350), Expect = 2e-31 Identities = 68/83 (81%), Positives = 78/83 (93%) Frame = +1 Query: 1 KKPVGDDYPGDEKEATTLVSWVRGLVRKNKASGAIDPKIRDTGPEEQMEEALKIGYLCTA 180 KKP+GDDYP +EK+AT LVSWVRGLVRKN+ S AIDPKIR+TGPE++MEEALKIGYLCTA Sbjct: 757 KKPIGDDYP-EEKDAT-LVSWVRGLVRKNQMSRAIDPKIRNTGPEQEMEEALKIGYLCTA 814 Query: 181 DLPSKRPSMQQVVGLLKDIEPTI 249 D+P KRPSMQQ+VGLLKDIEPT+ Sbjct: 815 DIPLKRPSMQQIVGLLKDIEPTV 837