BLASTX nr result
ID: Glycyrrhiza23_contig00022382
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00022382 (215 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACD56662.1| putative pentatricopeptide [Gossypium arboreum] 72 4e-11 gb|ACD56635.1| putative pentatricopeptide repeat protein [Gossyp... 72 4e-11 gb|AAT64030.1| putative pentatricopeptide repeat protein [Gossyp... 72 4e-11 ref|XP_003547177.1| PREDICTED: pentatricopeptide repeat-containi... 72 5e-11 gb|ACD56648.1| putative pentatricopeptide repeat protein [Gossyp... 70 1e-10 >gb|ACD56662.1| putative pentatricopeptide [Gossypium arboreum] Length = 805 Score = 72.4 bits (176), Expect = 4e-11 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +2 Query: 5 KFMSKTTRREIVLRDSNRFHHFKDGLCSCRGFW 103 KFMSK TRREIVLRDSNRFHHFKDG CSCRGFW Sbjct: 773 KFMSKETRREIVLRDSNRFHHFKDGYCSCRGFW 805 >gb|ACD56635.1| putative pentatricopeptide repeat protein [Gossypium raimondii] Length = 667 Score = 72.4 bits (176), Expect = 4e-11 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +2 Query: 5 KFMSKTTRREIVLRDSNRFHHFKDGLCSCRGFW 103 KFMSK TRREIVLRDSNRFHHFKDG CSCRGFW Sbjct: 635 KFMSKETRREIVLRDSNRFHHFKDGYCSCRGFW 667 >gb|AAT64030.1| putative pentatricopeptide repeat protein [Gossypium hirsutum] Length = 805 Score = 72.4 bits (176), Expect = 4e-11 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +2 Query: 5 KFMSKTTRREIVLRDSNRFHHFKDGLCSCRGFW 103 KFMSK TRREIVLRDSNRFHHFKDG CSCRGFW Sbjct: 773 KFMSKETRREIVLRDSNRFHHFKDGYCSCRGFW 805 >ref|XP_003547177.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Glycine max] Length = 1227 Score = 72.0 bits (175), Expect = 5e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 5 KFMSKTTRREIVLRDSNRFHHFKDGLCSCRGFW 103 KFMSKTTRREI+LRDSNRFHHFKDG CSCR FW Sbjct: 1195 KFMSKTTRREIILRDSNRFHHFKDGFCSCRDFW 1227 >gb|ACD56648.1| putative pentatricopeptide repeat protein [Gossypioides kirkii] Length = 805 Score = 70.5 bits (171), Expect = 1e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 5 KFMSKTTRREIVLRDSNRFHHFKDGLCSCRGFW 103 KFMSK TRREIVLRDSNRFHHFK+G CSCRGFW Sbjct: 773 KFMSKETRREIVLRDSNRFHHFKNGYCSCRGFW 805