BLASTX nr result
ID: Glycyrrhiza23_contig00022355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00022355 (216 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003528264.1| PREDICTED: protein CHUP1, chloroplastic-like... 100 2e-19 >ref|XP_003528264.1| PREDICTED: protein CHUP1, chloroplastic-like [Glycine max] Length = 293 Score = 99.8 bits (247), Expect = 2e-19 Identities = 50/70 (71%), Positives = 59/70 (84%) Frame = -2 Query: 212 EKRNKIEMPQNLLAGEFEDCELLIGAEKMDYVPEKELLQNLIENYKQREVNLERKLVELN 33 EK K EMPQNL GEF+D ELLI +EKM +KE+LQNL++NYKQREVNLERKL++LN Sbjct: 59 EKEIKFEMPQNLPTGEFKDLELLIDSEKMHNATKKEVLQNLVQNYKQREVNLERKLLKLN 118 Query: 32 SLKEEQSAIA 3 SL+EEQSAIA Sbjct: 119 SLREEQSAIA 128