BLASTX nr result
ID: Glycyrrhiza23_contig00022302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00022302 (537 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003609905.1| hypothetical protein MTR_4g124250 [Medicago ... 59 6e-07 gb|AFK44847.1| unknown [Lotus japonicus] 58 8e-07 gb|AFK48440.1| unknown [Lotus japonicus] 57 1e-06 ref|XP_003551004.1| PREDICTED: uncharacterized protein LOC100787... 57 1e-06 ref|XP_002314339.1| predicted protein [Populus trichocarpa] gi|1... 56 4e-06 >ref|XP_003609905.1| hypothetical protein MTR_4g124250 [Medicago truncatula] gi|355510960|gb|AES92102.1| hypothetical protein MTR_4g124250 [Medicago truncatula] Length = 77 Score = 58.5 bits (140), Expect = 6e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 520 EARRVMDLQGEVMACGYEDVQVMWSILDR 434 + RR+MDLQGEVMACGYEDVQVMWS+LDR Sbjct: 35 QERRIMDLQGEVMACGYEDVQVMWSMLDR 63 >gb|AFK44847.1| unknown [Lotus japonicus] Length = 73 Score = 58.2 bits (139), Expect = 8e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 535 AEAEAEARRVMDLQGEVMACGYEDVQVMWSILDR 434 AE E E R+MDLQGEVMACGYEDVQVMWSILD+ Sbjct: 30 AEQEQE-NRIMDLQGEVMACGYEDVQVMWSILDK 62 >gb|AFK48440.1| unknown [Lotus japonicus] Length = 75 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 520 EARRVMDLQGEVMACGYEDVQVMWSILDR 434 + R VMDLQGEVMACGYEDVQVMWSILDR Sbjct: 35 QERGVMDLQGEVMACGYEDVQVMWSILDR 63 >ref|XP_003551004.1| PREDICTED: uncharacterized protein LOC100787873 [Glycine max] Length = 75 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 520 EARRVMDLQGEVMACGYEDVQVMWSILDR 434 + R+VMDLQGEVMACGYEDVQVMWSILD+ Sbjct: 35 QERQVMDLQGEVMACGYEDVQVMWSILDK 63 >ref|XP_002314339.1| predicted protein [Populus trichocarpa] gi|118488665|gb|ABK96144.1| unknown [Populus trichocarpa] gi|222863379|gb|EEF00510.1| predicted protein [Populus trichocarpa] Length = 74 Score = 55.8 bits (133), Expect = 4e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 520 EARRVMDLQGEVMACGYEDVQVMWSILDR 434 E +RV+DL GEVMACGYEDVQVMWSILD+ Sbjct: 35 EEKRVLDLHGEVMACGYEDVQVMWSILDK 63