BLASTX nr result
ID: Glycyrrhiza23_contig00022288
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00022288 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003538839.1| PREDICTED: elongation of fatty acids protein... 117 1e-24 ref|XP_003611912.1| hypothetical protein MTR_5g019330 [Medicago ... 109 3e-22 ref|XP_002310199.1| predicted protein [Populus trichocarpa] gi|2... 103 1e-20 ref|XP_002533270.1| conserved hypothetical protein [Ricinus comm... 103 2e-20 ref|XP_004157860.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 102 2e-20 >ref|XP_003538839.1| PREDICTED: elongation of fatty acids protein A-like [Glycine max] Length = 323 Score = 117 bits (293), Expect = 1e-24 Identities = 63/93 (67%), Positives = 71/93 (76%), Gaps = 5/93 (5%) Frame = +1 Query: 1 PLVLNFQMVLLGCNLVCHVWVLLLHFSKGGCNGIGAWVLNSVLNSAILLLFVNFYVRVYL 180 PLVLN Q+ LLGCNLVCHV VLLLHF GGCNGIGAWV NSVLN AILLLF+NFYVR+YL Sbjct: 223 PLVLNCQIALLGCNLVCHVAVLLLHFLTGGCNGIGAWVFNSVLNGAILLLFLNFYVRMYL 282 Query: 181 GKGRK-----VNVVSEPGEDIARSCCVLGSGKE 264 + RK ++ E +IARS VLG+GKE Sbjct: 283 ARRRKRKGVVIDHRCENDNNIARS-SVLGAGKE 314 >ref|XP_003611912.1| hypothetical protein MTR_5g019330 [Medicago truncatula] gi|355513247|gb|AES94870.1| hypothetical protein MTR_5g019330 [Medicago truncatula] Length = 302 Score = 109 bits (272), Expect = 3e-22 Identities = 53/71 (74%), Positives = 58/71 (81%) Frame = +1 Query: 1 PLVLNFQMVLLGCNLVCHVWVLLLHFSKGGCNGIGAWVLNSVLNSAILLLFVNFYVRVYL 180 PLVLNFQMVLLGCNLVCHV VLLLH +GGCNGIGAWV NS+LN ILLLFVNFYVR Sbjct: 214 PLVLNFQMVLLGCNLVCHVGVLLLHLFRGGCNGIGAWVFNSILNGVILLLFVNFYVRAN- 272 Query: 181 GKGRKVNVVSE 213 GK +K +V + Sbjct: 273 GKKKKNEIVGD 283 >ref|XP_002310199.1| predicted protein [Populus trichocarpa] gi|222853102|gb|EEE90649.1| predicted protein [Populus trichocarpa] Length = 279 Score = 103 bits (257), Expect = 1e-20 Identities = 47/65 (72%), Positives = 54/65 (83%) Frame = +1 Query: 1 PLVLNFQMVLLGCNLVCHVWVLLLHFSKGGCNGIGAWVLNSVLNSAILLLFVNFYVRVYL 180 P VLN Q+VLLGCN+ CHV VL LHF KGGCNGIGAW NSVLN AIL LF+NFYV++YL Sbjct: 209 PFVLNCQIVLLGCNVACHVGVLSLHFMKGGCNGIGAWWFNSVLNGAILFLFLNFYVKMYL 268 Query: 181 GKGRK 195 GK ++ Sbjct: 269 GKRKE 273 >ref|XP_002533270.1| conserved hypothetical protein [Ricinus communis] gi|223526895|gb|EEF29102.1| conserved hypothetical protein [Ricinus communis] Length = 295 Score = 103 bits (256), Expect = 2e-20 Identities = 47/65 (72%), Positives = 54/65 (83%) Frame = +1 Query: 1 PLVLNFQMVLLGCNLVCHVWVLLLHFSKGGCNGIGAWVLNSVLNSAILLLFVNFYVRVYL 180 P V N Q+VLLGCNL CHV VLLLH KGGCNGIGAW+ NSVLN AILLLF+NFYV+++L Sbjct: 215 PFVENCQIVLLGCNLACHVGVLLLHLMKGGCNGIGAWIFNSVLNGAILLLFLNFYVKMHL 274 Query: 181 GKGRK 195 K +K Sbjct: 275 AKKKK 279 >ref|XP_004157860.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101229590 [Cucumis sativus] Length = 316 Score = 102 bits (255), Expect = 2e-20 Identities = 46/61 (75%), Positives = 52/61 (85%) Frame = +1 Query: 1 PLVLNFQMVLLGCNLVCHVWVLLLHFSKGGCNGIGAWVLNSVLNSAILLLFVNFYVRVYL 180 P V+N Q VLLGCNL CHV VLLLHF KGGCNGIGAW NSVLN AILLLF+NFY++++L Sbjct: 214 PFVVNCQFVLLGCNLACHVGVLLLHFMKGGCNGIGAWSFNSVLNGAILLLFLNFYLKIHL 273 Query: 181 G 183 G Sbjct: 274 G 274