BLASTX nr result
ID: Glycyrrhiza23_contig00022133
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00022133 (335 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003523948.1| PREDICTED: uncharacterized protein LOC100785... 70 2e-10 gb|ACU18276.1| unknown [Glycine max] 68 7e-10 gb|ACU20894.1| unknown [Glycine max] 58 7e-07 ref|XP_003542801.1| PREDICTED: uncharacterized protein LOC100810... 56 3e-06 ref|XP_003627969.1| hypothetical protein MTR_8g040640 [Medicago ... 55 8e-06 >ref|XP_003523948.1| PREDICTED: uncharacterized protein LOC100785636 [Glycine max] Length = 372 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +2 Query: 218 MDWYRGSRVNDFLVPKDQDLLDRHPSLDCWSNWEISAIE 334 MDWY G+ VND+LVP+DQDLLDRHPS D WSNW ISA E Sbjct: 1 MDWYYGNGVNDYLVPRDQDLLDRHPSPDYWSNWGISATE 39 >gb|ACU18276.1| unknown [Glycine max] Length = 109 Score = 68.2 bits (165), Expect = 7e-10 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 218 MDWYRGSRVNDFLVPKDQDLLDRHPSLDCWSNWEISAIE 334 MDWY G+ +ND+LVP+DQDLLDRHPS D WSNW I A E Sbjct: 1 MDWYYGNGINDYLVPRDQDLLDRHPSPDYWSNWGIGATE 39 >gb|ACU20894.1| unknown [Glycine max] Length = 150 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 335 LQLHLFPSLTNSPVKDACPINLDLWELENH 246 LQLHLFPSLTNS VKDACPIN DLWE +NH Sbjct: 121 LQLHLFPSLTNSLVKDACPINPDLWEPDNH 150 >ref|XP_003542801.1| PREDICTED: uncharacterized protein LOC100810608 [Glycine max] Length = 309 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Frame = +2 Query: 218 MDWYRGSRVNDFLVPKDQ-DLLDRHPSLDCWSNWEISAIE 334 MDWY G +DFLVPKDQ DLL+RHPS + WS W I+A E Sbjct: 1 MDWYYGCESSDFLVPKDQEDLLERHPSPENWSEWGINAPE 40 >ref|XP_003627969.1| hypothetical protein MTR_8g040640 [Medicago truncatula] gi|355521991|gb|AET02445.1| hypothetical protein MTR_8g040640 [Medicago truncatula] Length = 317 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/39 (58%), Positives = 27/39 (69%) Frame = +2 Query: 218 MDWYRGSRVNDFLVPKDQDLLDRHPSLDCWSNWEISAIE 334 MDWY G NDF+VP DQDL+ RHPS + WS W I+ E Sbjct: 12 MDWYYGCGTNDFVVPGDQDLMARHPSPENWSKWGINTPE 50