BLASTX nr result
ID: Glycyrrhiza23_contig00022127
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00022127 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003607061.1| Pentatricopeptide repeat-containing protein,... 69 4e-10 ref|XP_003589556.1| Pentatricopeptide repeat-containing protein ... 69 4e-10 ref|XP_003588289.1| Pentatricopeptide repeat-containing protein ... 69 4e-10 ref|XP_003528385.1| PREDICTED: pentatricopeptide repeat-containi... 55 4e-06 >ref|XP_003607061.1| Pentatricopeptide repeat-containing protein, partial [Medicago truncatula] gi|355508116|gb|AES89258.1| Pentatricopeptide repeat-containing protein, partial [Medicago truncatula] Length = 767 Score = 68.9 bits (167), Expect = 4e-10 Identities = 34/43 (79%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = +1 Query: 154 FRFDRSSA-EAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 F F A E RLPRPEVEVKELS+VPELWRRSRVAWLCKEL Sbjct: 91 FHFSTVEADEKRRLPRPEVEVKELSEVPELWRRSRVAWLCKEL 133 >ref|XP_003589556.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355478604|gb|AES59807.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 761 Score = 68.9 bits (167), Expect = 4e-10 Identities = 34/43 (79%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = +1 Query: 154 FRFDRSSA-EAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 F F A E RLPRPEVEVKELS+VPELWRRSRVAWLCKEL Sbjct: 91 FHFSTVEADEKRRLPRPEVEVKELSEVPELWRRSRVAWLCKEL 133 >ref|XP_003588289.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|357469333|ref|XP_003604951.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|357520985|ref|XP_003630781.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355477337|gb|AES58540.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355506006|gb|AES87148.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355524803|gb|AET05257.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 775 Score = 68.9 bits (167), Expect = 4e-10 Identities = 34/43 (79%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = +1 Query: 154 FRFDRSSA-EAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 F F A E RLPRPEVEVKELS+VPELWRRSRVAWLCKEL Sbjct: 91 FHFSTVEADEKRRLPRPEVEVKELSEVPELWRRSRVAWLCKEL 133 >ref|XP_003528385.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15820-like [Glycine max] Length = 763 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +1 Query: 169 SSAEAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 + AEA L PEVEV ELS VPE WRR+RVAWLCKEL Sbjct: 73 AEAEARGLRGPEVEVGELSAVPEEWRRARVAWLCKEL 109