BLASTX nr result
ID: Glycyrrhiza23_contig00021983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00021983 (481 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003602231.1| Histone-lysine N-methyltransferase ATX5 [Med... 130 1e-28 ref|XP_002513549.1| trithorax, putative [Ricinus communis] gi|22... 129 2e-28 ref|XP_002321418.1| SET domain protein [Populus trichocarpa] gi|... 127 1e-27 ref|XP_002268525.2| PREDICTED: histone-lysine N-methyltransferas... 126 2e-27 ref|XP_002265555.2| PREDICTED: histone-lysine N-methyltransferas... 126 2e-27 >ref|XP_003602231.1| Histone-lysine N-methyltransferase ATX5 [Medicago truncatula] gi|355491279|gb|AES72482.1| Histone-lysine N-methyltransferase ATX5 [Medicago truncatula] Length = 1053 Score = 130 bits (326), Expect = 1e-28 Identities = 58/61 (95%), Positives = 60/61 (98%) Frame = +3 Query: 3 PNCYARIMSVGDDESRIALIAKTNVSAGDELTYDYLFDPDEPDEFKVPCLCKSPNCRKFM 182 PNCYARIMSVGDDESRI LIAKTNVSAGDELTYDYLFDPDEPDEFKVPC+CK+PNCRKFM Sbjct: 993 PNCYARIMSVGDDESRIVLIAKTNVSAGDELTYDYLFDPDEPDEFKVPCMCKAPNCRKFM 1052 Query: 183 N 185 N Sbjct: 1053 N 1053 >ref|XP_002513549.1| trithorax, putative [Ricinus communis] gi|223547457|gb|EEF48952.1| trithorax, putative [Ricinus communis] Length = 1018 Score = 129 bits (324), Expect = 2e-28 Identities = 58/61 (95%), Positives = 60/61 (98%) Frame = +3 Query: 3 PNCYARIMSVGDDESRIALIAKTNVSAGDELTYDYLFDPDEPDEFKVPCLCKSPNCRKFM 182 PNCYARIMSVGDDESRI LIAKTNVSAGDELTYDYLFDPDEPDEFKVPCLCK+PNCR+FM Sbjct: 958 PNCYARIMSVGDDESRIVLIAKTNVSAGDELTYDYLFDPDEPDEFKVPCLCKAPNCRQFM 1017 Query: 183 N 185 N Sbjct: 1018 N 1018 >ref|XP_002321418.1| SET domain protein [Populus trichocarpa] gi|222868414|gb|EEF05545.1| SET domain protein [Populus trichocarpa] Length = 1070 Score = 127 bits (318), Expect = 1e-27 Identities = 57/61 (93%), Positives = 59/61 (96%) Frame = +3 Query: 3 PNCYARIMSVGDDESRIALIAKTNVSAGDELTYDYLFDPDEPDEFKVPCLCKSPNCRKFM 182 PNCYARIMSVGD+ESRI LIAKTNV AGDELTYDYLFDPDEPDEFKVPCLCK+PNCRKFM Sbjct: 1010 PNCYARIMSVGDNESRIVLIAKTNVPAGDELTYDYLFDPDEPDEFKVPCLCKAPNCRKFM 1069 Query: 183 N 185 N Sbjct: 1070 N 1070 >ref|XP_002268525.2| PREDICTED: histone-lysine N-methyltransferase ATX4-like [Vitis vinifera] Length = 1094 Score = 126 bits (317), Expect = 2e-27 Identities = 57/61 (93%), Positives = 59/61 (96%) Frame = +3 Query: 3 PNCYARIMSVGDDESRIALIAKTNVSAGDELTYDYLFDPDEPDEFKVPCLCKSPNCRKFM 182 PNCYARIMSVGDDESRI LIAKTNV+AGDELTYDYLFDPDEPDE KVPCLCK+PNCRKFM Sbjct: 1034 PNCYARIMSVGDDESRIVLIAKTNVAAGDELTYDYLFDPDEPDECKVPCLCKAPNCRKFM 1093 Query: 183 N 185 N Sbjct: 1094 N 1094 >ref|XP_002265555.2| PREDICTED: histone-lysine N-methyltransferase ATX5 [Vitis vinifera] Length = 105 Score = 126 bits (317), Expect = 2e-27 Identities = 57/61 (93%), Positives = 59/61 (96%) Frame = +3 Query: 3 PNCYARIMSVGDDESRIALIAKTNVSAGDELTYDYLFDPDEPDEFKVPCLCKSPNCRKFM 182 PNCYARIMSVGDDESRI LIAKTNV+AGDELTYDYLFDPDEPDE KVPCLCK+PNCRKFM Sbjct: 45 PNCYARIMSVGDDESRIVLIAKTNVAAGDELTYDYLFDPDEPDECKVPCLCKAPNCRKFM 104 Query: 183 N 185 N Sbjct: 105 N 105