BLASTX nr result
ID: Glycyrrhiza23_contig00021562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00021562 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003538658.1| PREDICTED: pentatricopeptide repeat-containi... 138 5e-31 ref|XP_003516732.1| PREDICTED: pentatricopeptide repeat-containi... 137 7e-31 ref|XP_003630734.1| Pentatricopeptide repeat-containing protein ... 134 8e-30 ref|XP_002267278.1| PREDICTED: pentatricopeptide repeat-containi... 130 1e-28 emb|CBI36294.3| unnamed protein product [Vitis vinifera] 130 1e-28 >ref|XP_003538658.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial-like [Glycine max] Length = 523 Score = 138 bits (347), Expect = 5e-31 Identities = 63/69 (91%), Positives = 65/69 (94%) Frame = -1 Query: 209 NVFTYNCIIKRLCKNEKVEEAYQLLDEMISGGVKPDTWSYNAIQAYHCDHCEVNRALRLM 30 NVFTYNCIIKRLCKNE VEEAY LLDEMIS GV+PDTWSYNAIQAYHCDHCEVNRA+RLM Sbjct: 320 NVFTYNCIIKRLCKNEHVEEAYLLLDEMISRGVRPDTWSYNAIQAYHCDHCEVNRAIRLM 379 Query: 29 SRMEKDNCL 3 RMEKDNCL Sbjct: 380 FRMEKDNCL 388 >ref|XP_003516732.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial-like [Glycine max] Length = 523 Score = 137 bits (346), Expect = 7e-31 Identities = 64/69 (92%), Positives = 65/69 (94%) Frame = -1 Query: 209 NVFTYNCIIKRLCKNEKVEEAYQLLDEMISGGVKPDTWSYNAIQAYHCDHCEVNRALRLM 30 NVFTYNCIIK+LCKNE VEEAYQLLDEMIS GVKPDTWSYNAIQAYHCDHCEVNRALRLM Sbjct: 320 NVFTYNCIIKQLCKNEHVEEAYQLLDEMISRGVKPDTWSYNAIQAYHCDHCEVNRALRLM 379 Query: 29 SRMEKDNCL 3 RMEKD CL Sbjct: 380 FRMEKDICL 388 >ref|XP_003630734.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355524756|gb|AET05210.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 520 Score = 134 bits (337), Expect = 8e-30 Identities = 61/68 (89%), Positives = 65/68 (95%) Frame = -1 Query: 209 NVFTYNCIIKRLCKNEKVEEAYQLLDEMISGGVKPDTWSYNAIQAYHCDHCEVNRALRLM 30 NVFTYNCIIKRLCK +KVEEAYQLLDEMIS G+KPDTWSYNAIQAYHCDHCEVNRAL+L+ Sbjct: 317 NVFTYNCIIKRLCKIKKVEEAYQLLDEMISSGLKPDTWSYNAIQAYHCDHCEVNRALKLI 376 Query: 29 SRMEKDNC 6 SRMEKD C Sbjct: 377 SRMEKDVC 384 >ref|XP_002267278.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial-like [Vitis vinifera] Length = 624 Score = 130 bits (327), Expect = 1e-28 Identities = 56/69 (81%), Positives = 65/69 (94%) Frame = -1 Query: 209 NVFTYNCIIKRLCKNEKVEEAYQLLDEMISGGVKPDTWSYNAIQAYHCDHCEVNRALRLM 30 NVFTYNCI+K+LCK+EKV+EAYQLLDEMI GV PD WSYNAIQA+HCDHCEVN+ALRL+ Sbjct: 323 NVFTYNCIVKKLCKSEKVDEAYQLLDEMIERGVSPDLWSYNAIQAFHCDHCEVNKALRLI 382 Query: 29 SRMEKDNCL 3 SRMEK+NC+ Sbjct: 383 SRMEKENCM 391 >emb|CBI36294.3| unnamed protein product [Vitis vinifera] Length = 517 Score = 130 bits (327), Expect = 1e-28 Identities = 56/69 (81%), Positives = 65/69 (94%) Frame = -1 Query: 209 NVFTYNCIIKRLCKNEKVEEAYQLLDEMISGGVKPDTWSYNAIQAYHCDHCEVNRALRLM 30 NVFTYNCI+K+LCK+EKV+EAYQLLDEMI GV PD WSYNAIQA+HCDHCEVN+ALRL+ Sbjct: 296 NVFTYNCIVKKLCKSEKVDEAYQLLDEMIERGVSPDLWSYNAIQAFHCDHCEVNKALRLI 355 Query: 29 SRMEKDNCL 3 SRMEK+NC+ Sbjct: 356 SRMEKENCM 364