BLASTX nr result
ID: Glycyrrhiza23_contig00021489
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00021489 (418 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003605194.1| aarF domain-containing protein kinase, putat... 103 2e-20 ref|XP_003516816.1| PREDICTED: uncharacterized aarF domain-conta... 102 4e-20 ref|XP_002523874.1| Ubiquinone biosynthesis protein coq-8, putat... 101 5e-20 ref|XP_003521978.1| PREDICTED: uncharacterized aarF domain-conta... 99 3e-19 ref|XP_003516441.1| PREDICTED: uncharacterized aarF domain-conta... 98 6e-19 >ref|XP_003605194.1| aarF domain-containing protein kinase, putative [Medicago truncatula] gi|355506249|gb|AES87391.1| aarF domain-containing protein kinase, putative [Medicago truncatula] Length = 713 Score = 103 bits (256), Expect = 2e-20 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +2 Query: 2 ELRNIFTRLGPTFVKLGQGLSTRPDICPPEFLEELSELQDGLPTFPDEQAFE 157 ELRNIFT+LGPTFVKLGQGLSTRPDICP E+LEELSELQDGLPTFPDE AFE Sbjct: 154 ELRNIFTKLGPTFVKLGQGLSTRPDICPSEYLEELSELQDGLPTFPDEDAFE 205 Score = 84.3 bits (207), Expect = 9e-15 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = +1 Query: 283 IGLDFYLVRGLGFLINKYVDAITSDVVALIDEFARRVFQELNYVQ 417 IGLDFYL+RGLGFLINKYVD IT+DVVALIDEFA RVFQELNYVQ Sbjct: 260 IGLDFYLIRGLGFLINKYVDRITTDVVALIDEFACRVFQELNYVQ 304 >ref|XP_003516816.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic-like isoform 1 [Glycine max] gi|356495917|ref|XP_003516817.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic-like isoform 2 [Glycine max] Length = 698 Score = 102 bits (253), Expect = 4e-20 Identities = 46/51 (90%), Positives = 51/51 (100%) Frame = +2 Query: 2 ELRNIFTRLGPTFVKLGQGLSTRPDICPPEFLEELSELQDGLPTFPDEQAF 154 EL++IFT+LGPTFVKLGQGLSTRPDICPPE+LEELSELQDGLPTFPDE+AF Sbjct: 139 ELKDIFTKLGPTFVKLGQGLSTRPDICPPEYLEELSELQDGLPTFPDEEAF 189 Score = 84.3 bits (207), Expect = 9e-15 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = +1 Query: 283 IGLDFYLVRGLGFLINKYVDAITSDVVALIDEFARRVFQELNYVQ 417 IGLDFYL+RGLG INKY+D ITSDVVALIDEFARRVFQELNYVQ Sbjct: 245 IGLDFYLIRGLGIFINKYIDIITSDVVALIDEFARRVFQELNYVQ 289 >ref|XP_002523874.1| Ubiquinone biosynthesis protein coq-8, putative [Ricinus communis] gi|223536962|gb|EEF38600.1| Ubiquinone biosynthesis protein coq-8, putative [Ricinus communis] Length = 528 Score = 101 bits (252), Expect = 5e-20 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = +2 Query: 2 ELRNIFTRLGPTFVKLGQGLSTRPDICPPEFLEELSELQDGLPTFPDEQAF 154 ELR IFTRLGPTFVKLGQGLSTRPDICPPE+LEELSELQD LPTFPDE+AF Sbjct: 127 ELRRIFTRLGPTFVKLGQGLSTRPDICPPEYLEELSELQDALPTFPDEEAF 177 Score = 85.1 bits (209), Expect = 5e-15 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = +1 Query: 283 IGLDFYLVRGLGFLINKYVDAITSDVVALIDEFARRVFQELNYVQ 417 IGLDFYL+RGLG LINKYVD ITSDVVALIDEFARRV+QELNYVQ Sbjct: 233 IGLDFYLIRGLGILINKYVDIITSDVVALIDEFARRVYQELNYVQ 277 >ref|XP_003521978.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic-like [Glycine max] Length = 722 Score = 99.4 bits (246), Expect = 3e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +2 Query: 2 ELRNIFTRLGPTFVKLGQGLSTRPDICPPEFLEELSELQDGLPTFPDEQAF 154 ELR+ FTRLGPTFVKLGQGLSTRPDICP E+LEELSELQDGLPTFPDE+AF Sbjct: 163 ELRDTFTRLGPTFVKLGQGLSTRPDICPAEYLEELSELQDGLPTFPDEEAF 213 Score = 84.3 bits (207), Expect = 9e-15 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = +1 Query: 283 IGLDFYLVRGLGFLINKYVDAITSDVVALIDEFARRVFQELNYVQ 417 IG+DFYL+RGLG LINKYVD ITSDVVALIDEFARRVFQELNYVQ Sbjct: 269 IGMDFYLIRGLGSLINKYVDFITSDVVALIDEFARRVFQELNYVQ 313 >ref|XP_003516441.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic-like [Glycine max] Length = 726 Score = 98.2 bits (243), Expect = 6e-19 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +2 Query: 2 ELRNIFTRLGPTFVKLGQGLSTRPDICPPEFLEELSELQDGLPTFPDEQAF 154 ELR+ FTRLGPTFVKLGQGLSTRPDICP E+LEEL+ELQDGLPTFPDE+AF Sbjct: 167 ELRDTFTRLGPTFVKLGQGLSTRPDICPAEYLEELTELQDGLPTFPDEEAF 217 Score = 84.3 bits (207), Expect = 9e-15 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = +1 Query: 283 IGLDFYLVRGLGFLINKYVDAITSDVVALIDEFARRVFQELNYVQ 417 IG+DFYL+RGLG LINKYVD ITSDVVALIDEFARRVFQELNYVQ Sbjct: 273 IGMDFYLIRGLGSLINKYVDFITSDVVALIDEFARRVFQELNYVQ 317