BLASTX nr result
ID: Glycyrrhiza23_contig00021280
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00021280 (278 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003630146.1| hypothetical protein MTR_8g092300 [Medicago ... 95 5e-18 ref|XP_003524287.1| PREDICTED: uncharacterized protein LOC100813... 93 3e-17 ref|XP_002275413.2| PREDICTED: uncharacterized protein LOC100254... 86 3e-15 emb|CBI21541.3| unnamed protein product [Vitis vinifera] 86 4e-15 ref|XP_002530263.1| conserved hypothetical protein [Ricinus comm... 86 4e-15 >ref|XP_003630146.1| hypothetical protein MTR_8g092300 [Medicago truncatula] gi|355524168|gb|AET04622.1| hypothetical protein MTR_8g092300 [Medicago truncatula] Length = 578 Score = 95.1 bits (235), Expect = 5e-18 Identities = 45/50 (90%), Positives = 49/50 (98%) Frame = -3 Query: 276 LLKDLMTEGLLGGDRRLGQVCSKRVYRIMMAQRGSIRTDDVEDGADFFER 127 LLKDLMTEGLLGGDRRLG+VCSKRV+RI+MAQ GSIRTDDVE+GADFFER Sbjct: 529 LLKDLMTEGLLGGDRRLGEVCSKRVFRILMAQNGSIRTDDVENGADFFER 578 >ref|XP_003524287.1| PREDICTED: uncharacterized protein LOC100813276 [Glycine max] Length = 624 Score = 92.8 bits (229), Expect = 3e-17 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = -3 Query: 276 LLKDLMTEGLLGGDRRLGQVCSKRVYRIMMAQRGSIRTDDVEDGADFFER 127 LL+DLMTEGLLGGDRRLG+VCSKRVYRI+MAQ G IRTDDVE+GADFFER Sbjct: 573 LLQDLMTEGLLGGDRRLGEVCSKRVYRILMAQSGCIRTDDVENGADFFER 622 >ref|XP_002275413.2| PREDICTED: uncharacterized protein LOC100254360 [Vitis vinifera] Length = 678 Score = 85.9 bits (211), Expect = 3e-15 Identities = 42/64 (65%), Positives = 51/64 (79%) Frame = -3 Query: 276 LLKDLMTEGLLGGDRRLGQVCSKRVYRIMMAQRGSIRTDDVEDGADFFER*SIMKSFVIV 97 LLKDL TEGLLG DRRLG+VCSKRVYRI+MAQ G+++TDDVEDGADFF S + ++ Sbjct: 529 LLKDLTTEGLLGEDRRLGEVCSKRVYRILMAQSGNMKTDDVEDGADFFRHQSSPQLIKLL 588 Query: 96 SLRK 85 + K Sbjct: 589 IMEK 592 >emb|CBI21541.3| unnamed protein product [Vitis vinifera] Length = 443 Score = 85.5 bits (210), Expect = 4e-15 Identities = 40/48 (83%), Positives = 45/48 (93%) Frame = -3 Query: 276 LLKDLMTEGLLGGDRRLGQVCSKRVYRIMMAQRGSIRTDDVEDGADFF 133 LLKDL TEGLLG DRRLG+VCSKRVYRI+MAQ G+++TDDVEDGADFF Sbjct: 391 LLKDLTTEGLLGEDRRLGEVCSKRVYRILMAQSGNMKTDDVEDGADFF 438 >ref|XP_002530263.1| conserved hypothetical protein [Ricinus communis] gi|223530229|gb|EEF32133.1| conserved hypothetical protein [Ricinus communis] Length = 400 Score = 85.5 bits (210), Expect = 4e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = -3 Query: 276 LLKDLMTEGLLGGDRRLGQVCSKRVYRIMMAQRGSIRTDDVEDGADFF 133 LL+DL TEGLLGG+RR+G++CSKR+YRI+MAQ GSI+TDDVEDGADFF Sbjct: 348 LLEDLTTEGLLGGERRVGRICSKRIYRILMAQSGSIKTDDVEDGADFF 395