BLASTX nr result
ID: Glycyrrhiza23_contig00021194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00021194 (378 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003603512.1| DDB1- and CUL4-associated factor-like protei... 65 6e-09 ref|XP_003527808.1| PREDICTED: DDB1- and CUL4-associated factor ... 64 1e-08 ref|XP_003523712.1| PREDICTED: DDB1- and CUL4-associated factor ... 64 1e-08 ref|XP_002528006.1| conserved hypothetical protein [Ricinus comm... 62 4e-08 ref|XP_004162499.1| PREDICTED: LOW QUALITY PROTEIN: DDB1- and CU... 62 6e-08 >ref|XP_003603512.1| DDB1- and CUL4-associated factor-like protein [Medicago truncatula] gi|355492560|gb|AES73763.1| DDB1- and CUL4-associated factor-like protein [Medicago truncatula] Length = 805 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 PTDSFVGLITMDDQGEMYSSARVYEIGRRRPT 98 PTDSFVGLITMDDQG+MYSSAR YEIGRRRPT Sbjct: 666 PTDSFVGLITMDDQGDMYSSARSYEIGRRRPT 697 >ref|XP_003527808.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like [Glycine max] Length = 1868 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 PTDSFVGLITMDDQGEMYSSARVYEIGRRRPT 98 PTDSFVGLITMDDQ EMY+SAR+YEIGRRRPT Sbjct: 1726 PTDSFVGLITMDDQDEMYASARIYEIGRRRPT 1757 >ref|XP_003523712.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like [Glycine max] Length = 1857 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 PTDSFVGLITMDDQGEMYSSARVYEIGRRRPT 98 PTDSFVGLITMDDQ EMY+SAR+YEIGRRRPT Sbjct: 1715 PTDSFVGLITMDDQDEMYASARIYEIGRRRPT 1746 >ref|XP_002528006.1| conserved hypothetical protein [Ricinus communis] gi|223532632|gb|EEF34418.1| conserved hypothetical protein [Ricinus communis] Length = 1871 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 6 TDSFVGLITMDDQGEMYSSARVYEIGRRRPT 98 TDSFVGLITMDDQ EMYSSAR+YEIGRRRPT Sbjct: 1725 TDSFVGLITMDDQEEMYSSARIYEIGRRRPT 1755 >ref|XP_004162499.1| PREDICTED: LOW QUALITY PROTEIN: DDB1- and CUL4-associated factor homolog 1-like [Cucumis sativus] Length = 1900 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 6 TDSFVGLITMDDQGEMYSSARVYEIGRRRPT 98 TDSFVGLITMDDQ EM+SSARVYEIGRRRPT Sbjct: 1760 TDSFVGLITMDDQDEMFSSARVYEIGRRRPT 1790