BLASTX nr result
ID: Glycyrrhiza23_contig00020990
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00020990 (429 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612692.1| Nbs-lrr resistance protein [Medicago truncat... 79 5e-13 ref|XP_003612696.1| Nbs-lrr resistance protein [Medicago truncat... 77 1e-12 ref|XP_003517650.1| PREDICTED: disease resistance protein RPM1-l... 74 2e-11 >ref|XP_003612692.1| Nbs-lrr resistance protein [Medicago truncatula] gi|355514027|gb|AES95650.1| Nbs-lrr resistance protein [Medicago truncatula] Length = 946 Score = 78.6 bits (192), Expect = 5e-13 Identities = 36/44 (81%), Positives = 36/44 (81%) Frame = -1 Query: 429 IAEVYSTYSTDGGWDVYALDSFRDCSPRSGTVMRSHERRTPWKV 298 I EVYSTY DGGWDVYALDS RDCSPRSGTV RSHE R WKV Sbjct: 903 IPEVYSTYWRDGGWDVYALDSLRDCSPRSGTVRRSHECRNQWKV 946 >ref|XP_003612696.1| Nbs-lrr resistance protein [Medicago truncatula] gi|355514031|gb|AES95654.1| Nbs-lrr resistance protein [Medicago truncatula] Length = 954 Score = 77.0 bits (188), Expect = 1e-12 Identities = 35/44 (79%), Positives = 36/44 (81%) Frame = -1 Query: 429 IAEVYSTYSTDGGWDVYALDSFRDCSPRSGTVMRSHERRTPWKV 298 I EVYSTY DGGWDVYALDS RDCSPRSGT+ RSHE R WKV Sbjct: 911 IPEVYSTYWRDGGWDVYALDSRRDCSPRSGTLRRSHESRNQWKV 954 >ref|XP_003517650.1| PREDICTED: disease resistance protein RPM1-like [Glycine max] Length = 946 Score = 73.6 bits (179), Expect = 2e-11 Identities = 36/45 (80%), Positives = 37/45 (82%), Gaps = 1/45 (2%) Frame = -1 Query: 429 IAEVYSTYSTDGGWDVYALDSF-RDCSPRSGTVMRSHERRTPWKV 298 I VYSTY D GWDVYALDSF R+CSPRSGTVMRSHE RT WKV Sbjct: 902 IPNVYSTYWRDDGWDVYALDSFSRNCSPRSGTVMRSHEPRTLWKV 946