BLASTX nr result
ID: Glycyrrhiza23_contig00020686
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00020686 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003539838.1| PREDICTED: uncharacterized protein LOC100809... 64 1e-08 ref|XP_003538105.1| PREDICTED: uncharacterized protein LOC100780... 64 1e-08 ref|XP_002313608.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-08 ref|XP_003596867.1| OTU domain-containing protein [Medicago trun... 64 2e-08 ref|XP_002523840.1| expressed protein, putative [Ricinus communi... 62 6e-08 >ref|XP_003539838.1| PREDICTED: uncharacterized protein LOC100809162 [Glycine max] Length = 519 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 3 YSIFGDDVDSMVCYLLETGSSSRRKGKATE 92 YSIFGDDVDSMVCYLLETGSSSRRKGKATE Sbjct: 490 YSIFGDDVDSMVCYLLETGSSSRRKGKATE 519 >ref|XP_003538105.1| PREDICTED: uncharacterized protein LOC100780250 [Glycine max] Length = 520 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 3 YSIFGDDVDSMVCYLLETGSSSRRKGKATE 92 YSIFGDDVDSMVCYLLETGSSSRRKGKATE Sbjct: 491 YSIFGDDVDSMVCYLLETGSSSRRKGKATE 520 >ref|XP_002313608.1| predicted protein [Populus trichocarpa] gi|222850016|gb|EEE87563.1| predicted protein [Populus trichocarpa] Length = 534 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 3 YSIFGDDVDSMVCYLLETGSSSRRKGKATE 92 YSIFGDDVDSMVCYLLETGSSSRRKGKATE Sbjct: 505 YSIFGDDVDSMVCYLLETGSSSRRKGKATE 534 >ref|XP_003596867.1| OTU domain-containing protein [Medicago truncatula] gi|355485915|gb|AES67118.1| OTU domain-containing protein [Medicago truncatula] Length = 253 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 3 YSIFGDDVDSMVCYLLETGSSSRRKGKATE 92 YSIFGDDVDSM+CYLLETGSSSRRKGKATE Sbjct: 224 YSIFGDDVDSMICYLLETGSSSRRKGKATE 253 >ref|XP_002523840.1| expressed protein, putative [Ricinus communis] gi|223536928|gb|EEF38566.1| expressed protein, putative [Ricinus communis] Length = 534 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 3 YSIFGDDVDSMVCYLLETGSSSRRKGKATE 92 YSIFGDDVDSMVCYLLET SSSRRKGKATE Sbjct: 505 YSIFGDDVDSMVCYLLETASSSRRKGKATE 534