BLASTX nr result
ID: Glycyrrhiza23_contig00020349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00020349 (224 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003552959.1| PREDICTED: UPF0503 protein At3g09070, chloro... 72 4e-11 ref|XP_004143144.1| PREDICTED: UPF0503 protein At3g09070, chloro... 64 1e-08 ref|XP_002520430.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 ref|XP_002299829.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_002314125.1| predicted protein [Populus trichocarpa] gi|2... 58 7e-07 >ref|XP_003552959.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Glycine max] Length = 544 Score = 72.4 bits (176), Expect = 4e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 110 MTTKTHRLTTCHRHPTKPVTGFCAYCLRERLAGIESS 220 MT+KTHR TTCHRHP+ PVTGFCA CLRERLAGI+SS Sbjct: 1 MTSKTHRFTTCHRHPSTPVTGFCASCLRERLAGIDSS 37 >ref|XP_004143144.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Cucumis sativus] gi|449496609|ref|XP_004160178.1| PREDICTED: UPF0503 protein At3g09070, chloroplastic-like [Cucumis sativus] Length = 575 Score = 63.9 bits (154), Expect = 1e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 122 THRLTTCHRHPTKPVTGFCAYCLRERLAGIE 214 +HRL+TCHRHP+KPVTGFCA CLRERLAGI+ Sbjct: 9 SHRLSTCHRHPSKPVTGFCASCLRERLAGID 39 >ref|XP_002520430.1| conserved hypothetical protein [Ricinus communis] gi|223540272|gb|EEF41843.1| conserved hypothetical protein [Ricinus communis] Length = 576 Score = 61.6 bits (148), Expect = 6e-08 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = +2 Query: 95 LPLSPMTTKTHRLTTCHRHPTKPVTGFCAYCLRERLAGIE 214 + + P HR +TCHRHPT+P+TGFCA CLRERLAGI+ Sbjct: 1 MTVPPKPLHHHRHSTCHRHPTRPITGFCASCLRERLAGID 40 >ref|XP_002299829.1| predicted protein [Populus trichocarpa] gi|222847087|gb|EEE84634.1| predicted protein [Populus trichocarpa] Length = 553 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +2 Query: 98 PLSPMTTKTHRLTTCHRHPTKPVTGFCAYCLRERLAGIE 214 PL P K HR ++C+RHP+KP+TGFCA CLRERLAGI+ Sbjct: 4 PLQPQLQK-HRHSSCNRHPSKPITGFCASCLRERLAGID 41 >ref|XP_002314125.1| predicted protein [Populus trichocarpa] gi|222850533|gb|EEE88080.1| predicted protein [Populus trichocarpa] Length = 552 Score = 58.2 bits (139), Expect = 7e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 125 HRLTTCHRHPTKPVTGFCAYCLRERLAGIE 214 HR +CHRHP+KP+TGFCA CLRERLAGI+ Sbjct: 12 HRHPSCHRHPSKPITGFCASCLRERLAGID 41