BLASTX nr result
ID: Glycyrrhiza23_contig00020310
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00020310 (398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309194.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 gb|AAG40371.1|AF325019_1 AT4g27960 [Arabidopsis thaliana] 58 9e-07 ref|NP_567791.1| SUMO-conjugating enzyme UBC9 [Arabidopsis thali... 56 3e-06 ref|XP_003589256.1| Ubiquitin carrier protein [Medicago truncatu... 56 4e-06 gb|AAV34697.1| ubiquitin-conjugating enzyme [Arachis hypogaea] 56 4e-06 >ref|XP_002309194.1| predicted protein [Populus trichocarpa] gi|222855170|gb|EEE92717.1| predicted protein [Populus trichocarpa] Length = 223 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 101 CFSGLLAMASKRITKELKDLQKDPPVSCSAGPV 3 C G++ MASKRI KELKDLQKDPP SCSAGPV Sbjct: 69 CIGGVIIMASKRILKELKDLQKDPPTSCSAGPV 101 >gb|AAG40371.1|AF325019_1 AT4g27960 [Arabidopsis thaliana] Length = 178 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 95 SGLLAMASKRITKELKDLQKDPPVSCSAGPV 3 SG+L MASKRI KELKDLQKDPP SCSAGPV Sbjct: 26 SGILEMASKRILKELKDLQKDPPTSCSAGPV 56 >ref|NP_567791.1| SUMO-conjugating enzyme UBC9 [Arabidopsis thaliana] gi|66354424|gb|AAY44849.1| ubiquitinating enzyme [Arabidopsis thaliana] gi|332660014|gb|AEE85414.1| SUMO-conjugating enzyme UBC9 [Arabidopsis thaliana] Length = 178 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 92 GLLAMASKRITKELKDLQKDPPVSCSAGPV 3 G+L MASKRI KELKDLQKDPP SCSAGPV Sbjct: 27 GILEMASKRILKELKDLQKDPPTSCSAGPV 56 >ref|XP_003589256.1| Ubiquitin carrier protein [Medicago truncatula] gi|355478304|gb|AES59507.1| Ubiquitin carrier protein [Medicago truncatula] Length = 148 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 80 MASKRITKELKDLQKDPPVSCSAGPV 3 MASKRITKELKDLQKDPPVSCSAGPV Sbjct: 1 MASKRITKELKDLQKDPPVSCSAGPV 26 >gb|AAV34697.1| ubiquitin-conjugating enzyme [Arachis hypogaea] Length = 148 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 80 MASKRITKELKDLQKDPPVSCSAGPV 3 MASKRITKELKDLQKDPPVSCSAGPV Sbjct: 1 MASKRITKELKDLQKDPPVSCSAGPV 26