BLASTX nr result
ID: Glycyrrhiza23_contig00020054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00020054 (203 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003556942.1| PREDICTED: hydroquinone glucosyltransferase-... 57 2e-06 >ref|XP_003556942.1| PREDICTED: hydroquinone glucosyltransferase-like isoform 1 [Glycine max] gi|356577662|ref|XP_003556943.1| PREDICTED: hydroquinone glucosyltransferase-like isoform 2 [Glycine max] Length = 464 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/65 (46%), Positives = 39/65 (60%) Frame = -2 Query: 202 AKRFHLANGVFVNSFVELEEGAIRASQEQIKEIALAALTRRDSYSRQSRSIKDKPKVYPV 23 +KRFH+ +GVF+N+F+ELE GAIRA +E +K KPK+YPV Sbjct: 198 SKRFHVPDGVFMNTFLELESGAIRALEEH---------------------VKGKPKLYPV 236 Query: 22 GPIIQ 8 GPIIQ Sbjct: 237 GPIIQ 241