BLASTX nr result
ID: Glycyrrhiza23_contig00020001
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00020001 (364 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003637382.1| hypothetical protein MTR_084s0004 [Medicago ... 60 2e-07 ref|XP_003637240.1| Receptor ser thr protein kinase [Medicago tr... 60 2e-07 >ref|XP_003637382.1| hypothetical protein MTR_084s0004 [Medicago truncatula] gi|355503317|gb|AES84520.1| hypothetical protein MTR_084s0004 [Medicago truncatula] Length = 392 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 264 EE*SHSRIIMSCGCIGASTLKKKRSPSHAPNE 359 EE SH+RIIMSCGC GASTLKKKRSP H PNE Sbjct: 11 EEQSHTRIIMSCGCFGASTLKKKRSPPHTPNE 42 >ref|XP_003637240.1| Receptor ser thr protein kinase [Medicago truncatula] gi|355503175|gb|AES84378.1| Receptor ser thr protein kinase [Medicago truncatula] Length = 132 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 264 EE*SHSRIIMSCGCIGASTLKKKRSPSHAPNE 359 EE SH+RIIMSCGC GASTLKKKRSP H PNE Sbjct: 11 EEQSHTRIIMSCGCFGASTLKKKRSPPHTPNE 42