BLASTX nr result
ID: Glycyrrhiza23_contig00019856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00019856 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003617395.1| hypothetical protein MTR_5g091100 [Medicago ... 95 7e-18 >ref|XP_003617395.1| hypothetical protein MTR_5g091100 [Medicago truncatula] gi|355518730|gb|AET00354.1| hypothetical protein MTR_5g091100 [Medicago truncatula] Length = 144 Score = 94.7 bits (234), Expect = 7e-18 Identities = 46/71 (64%), Positives = 53/71 (74%), Gaps = 4/71 (5%) Frame = -2 Query: 284 HSVHEFEWLNTI---EPINPPNDVI-MNWFSDGIVGTVDFDFGYANGECYSQICDGFFSN 117 H VH+FEWLN + EP NP +DV+ MNWFSD VG +DFDFGY NGE QICDG FSN Sbjct: 75 HYVHDFEWLNMMDMMEPANPLDDVVTMNWFSDD-VGRLDFDFGYVNGEFCPQICDGHFSN 133 Query: 116 DASYGYLWEDY 84 DA+YG LW +Y Sbjct: 134 DANYGCLWGEY 144