BLASTX nr result
ID: Glycyrrhiza23_contig00019836
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00019836 (362 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003527808.1| PREDICTED: DDB1- and CUL4-associated factor ... 66 3e-09 ref|XP_003523712.1| PREDICTED: DDB1- and CUL4-associated factor ... 66 3e-09 ref|XP_002280997.2| PREDICTED: DDB1- and CUL4-associated factor ... 64 1e-08 emb|CBI20820.3| unnamed protein product [Vitis vinifera] 64 1e-08 ref|XP_002528006.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 >ref|XP_003527808.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like [Glycine max] Length = 1868 Score = 66.2 bits (160), Expect = 3e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 360 PTDSFVGLVTMDDHDEMYASARIYEIGRRRPT 265 PTDSFVGL+TMDD DEMYASARIYEIGRRRPT Sbjct: 1726 PTDSFVGLITMDDQDEMYASARIYEIGRRRPT 1757 >ref|XP_003523712.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like [Glycine max] Length = 1857 Score = 66.2 bits (160), Expect = 3e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 360 PTDSFVGLVTMDDHDEMYASARIYEIGRRRPT 265 PTDSFVGL+TMDD DEMYASARIYEIGRRRPT Sbjct: 1715 PTDSFVGLITMDDQDEMYASARIYEIGRRRPT 1746 >ref|XP_002280997.2| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like [Vitis vinifera] Length = 2024 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 360 PTDSFVGLVTMDDHDEMYASARIYEIGRRRPT 265 PTDSFVGLV+MDDHDEM++SAR+YEIGRRRPT Sbjct: 1880 PTDSFVGLVSMDDHDEMFSSARMYEIGRRRPT 1911 >emb|CBI20820.3| unnamed protein product [Vitis vinifera] Length = 1760 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 360 PTDSFVGLVTMDDHDEMYASARIYEIGRRRPT 265 PTDSFVGLV+MDDHDEM++SAR+YEIGRRRPT Sbjct: 1616 PTDSFVGLVSMDDHDEMFSSARMYEIGRRRPT 1647 >ref|XP_002528006.1| conserved hypothetical protein [Ricinus communis] gi|223532632|gb|EEF34418.1| conserved hypothetical protein [Ricinus communis] Length = 1871 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 357 TDSFVGLVTMDDHDEMYASARIYEIGRRRPT 265 TDSFVGL+TMDD +EMY+SARIYEIGRRRPT Sbjct: 1725 TDSFVGLITMDDQEEMYSSARIYEIGRRRPT 1755