BLASTX nr result
ID: Glycyrrhiza23_contig00019729
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00019729 (326 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612242.1| Aspartic proteinase-like protein [Medicago t... 61 8e-08 >ref|XP_003612242.1| Aspartic proteinase-like protein [Medicago truncatula] gi|355513577|gb|AES95200.1| Aspartic proteinase-like protein [Medicago truncatula] Length = 527 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/41 (73%), Positives = 34/41 (82%), Gaps = 2/41 (4%) Frame = -3 Query: 324 SNLPVNRSHSP--SPALAVNPEATANQSNDPARLPSSHSFK 208 S+LPVNRSH+P SPA+AVNPE +N SN P RLPSSHSFK Sbjct: 467 SSLPVNRSHAPAVSPAMAVNPEIQSNPSNGPQRLPSSHSFK 507