BLASTX nr result
ID: Glycyrrhiza23_contig00019700
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00019700 (478 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003542514.1| PREDICTED: E3 ubiquitin-protein ligase MGRN1... 130 1e-28 ref|XP_003537289.1| PREDICTED: E3 ubiquitin-protein ligase MGRN1... 130 1e-28 ref|NP_566356.1| RING/U-box domain-containing protein [Arabidops... 128 5e-28 ref|XP_002884754.1| hypothetical protein ARALYDRAFT_478299 [Arab... 128 5e-28 ref|XP_002519543.1| mahogunin, putative [Ricinus communis] gi|22... 127 1e-27 >ref|XP_003542514.1| PREDICTED: E3 ubiquitin-protein ligase MGRN1-like [Glycine max] Length = 349 Score = 130 bits (327), Expect = 1e-28 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 3 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKVG 176 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKVG Sbjct: 287 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKVG 344 >ref|XP_003537289.1| PREDICTED: E3 ubiquitin-protein ligase MGRN1-like [Glycine max] Length = 349 Score = 130 bits (327), Expect = 1e-28 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 3 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKVG 176 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKVG Sbjct: 287 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKVG 344 >ref|NP_566356.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|75313015|sp|Q9S752.1|LOFG2_ARATH RecName: Full=Probable E3 ubiquitin-protein ligase LOG2; AltName: Full=Protein LOSS OF GDU2; AltName: Full=RING finger protein 215 gi|6681341|gb|AAF23258.1|AC015985_16 putative RING zinc finger protein [Arabidopsis thaliana] gi|6682260|gb|AAF23312.1|AC016661_37 unknown protein [Arabidopsis thaliana] gi|18377644|gb|AAL66972.1| putative RING zinc finger protein [Arabidopsis thaliana] gi|21593417|gb|AAM65384.1| putative RING zinc finger protein [Arabidopsis thaliana] gi|332641289|gb|AEE74810.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Length = 388 Score = 128 bits (321), Expect = 5e-28 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = +3 Query: 3 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKV 173 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKV Sbjct: 313 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKV 369 >ref|XP_002884754.1| hypothetical protein ARALYDRAFT_478299 [Arabidopsis lyrata subsp. lyrata] gi|297330594|gb|EFH61013.1| hypothetical protein ARALYDRAFT_478299 [Arabidopsis lyrata subsp. lyrata] Length = 385 Score = 128 bits (321), Expect = 5e-28 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = +3 Query: 3 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKV 173 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKV Sbjct: 310 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKV 366 >ref|XP_002519543.1| mahogunin, putative [Ricinus communis] gi|223541406|gb|EEF42957.1| mahogunin, putative [Ricinus communis] Length = 306 Score = 127 bits (318), Expect = 1e-27 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = +3 Query: 3 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKV 173 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLR+QTNRCPICRQPVERLLEIKV Sbjct: 244 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRYQTNRCPICRQPVERLLEIKV 300