BLASTX nr result
ID: Glycyrrhiza23_contig00019699
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00019699 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003542514.1| PREDICTED: E3 ubiquitin-protein ligase MGRN1... 135 3e-30 ref|XP_003537289.1| PREDICTED: E3 ubiquitin-protein ligase MGRN1... 131 5e-29 ref|XP_004137817.1| PREDICTED: probable E3 ubiquitin-protein lig... 124 6e-27 ref|XP_002519543.1| mahogunin, putative [Ricinus communis] gi|22... 124 6e-27 ref|XP_002326350.1| predicted protein [Populus trichocarpa] gi|2... 124 6e-27 >ref|XP_003542514.1| PREDICTED: E3 ubiquitin-protein ligase MGRN1-like [Glycine max] Length = 349 Score = 135 bits (340), Expect = 3e-30 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +3 Query: 3 NDPGKECVICLSEPRDTTVLPCCHMCMCSGCAKVLWFQTNRCPICRQPVERLLEIKVGPE 182 NDPGKECVICLSEPRDTTVLPC HMCMCSGCAKVL FQTNRCPICRQPVERLLEIKVGPE Sbjct: 287 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKVGPE 346 Query: 183 PEE 191 PEE Sbjct: 347 PEE 349 >ref|XP_003537289.1| PREDICTED: E3 ubiquitin-protein ligase MGRN1-like [Glycine max] Length = 349 Score = 131 bits (330), Expect = 5e-29 Identities = 60/63 (95%), Positives = 60/63 (95%) Frame = +3 Query: 3 NDPGKECVICLSEPRDTTVLPCCHMCMCSGCAKVLWFQTNRCPICRQPVERLLEIKVGPE 182 NDPGKECVICLSEPRDTTVLPC HMCMCSGCAKVL FQTNRCPICRQPVERLLEIKVGPE Sbjct: 287 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKVGPE 346 Query: 183 PEE 191 EE Sbjct: 347 LEE 349 >ref|XP_004137817.1| PREDICTED: probable E3 ubiquitin-protein ligase LOG2-like [Cucumis sativus] gi|449513666|ref|XP_004164388.1| PREDICTED: probable E3 ubiquitin-protein ligase LOG2-like [Cucumis sativus] Length = 368 Score = 124 bits (312), Expect = 6e-27 Identities = 56/63 (88%), Positives = 58/63 (92%) Frame = +3 Query: 3 NDPGKECVICLSEPRDTTVLPCCHMCMCSGCAKVLWFQTNRCPICRQPVERLLEIKVGPE 182 NDPGKECVICLSEPRDTTVLPC HMCMCSGCAKVL FQTNRCPICRQPV+RLLEI+V Sbjct: 305 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVDRLLEIRVSNG 364 Query: 183 PEE 191 PEE Sbjct: 365 PEE 367 >ref|XP_002519543.1| mahogunin, putative [Ricinus communis] gi|223541406|gb|EEF42957.1| mahogunin, putative [Ricinus communis] Length = 306 Score = 124 bits (312), Expect = 6e-27 Identities = 56/63 (88%), Positives = 58/63 (92%) Frame = +3 Query: 3 NDPGKECVICLSEPRDTTVLPCCHMCMCSGCAKVLWFQTNRCPICRQPVERLLEIKVGPE 182 NDPGKECVICLSEPRDTTVLPC HMCMCSGCAKVL +QTNRCPICRQPVERLLEIKV Sbjct: 244 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRYQTNRCPICRQPVERLLEIKVNNG 303 Query: 183 PEE 191 P+E Sbjct: 304 PDE 306 >ref|XP_002326350.1| predicted protein [Populus trichocarpa] gi|222833543|gb|EEE72020.1| predicted protein [Populus trichocarpa] Length = 284 Score = 124 bits (312), Expect = 6e-27 Identities = 56/63 (88%), Positives = 58/63 (92%) Frame = +3 Query: 3 NDPGKECVICLSEPRDTTVLPCCHMCMCSGCAKVLWFQTNRCPICRQPVERLLEIKVGPE 182 NDPGKECVICLSEPRDTTVLPC HMCMCSGCAKVL FQTNRCPICRQPV+RLLEIKV Sbjct: 222 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVDRLLEIKVNNG 281 Query: 183 PEE 191 P+E Sbjct: 282 PDE 284